PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10013716
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family STAT
Protein Properties Length: 705aa    MW: 79636 Da    PI: 5.4531
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10013716genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT189.63.7e-592323511120
         STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfeipklkkypfl 98 
                  ldvvllna+ q+++k++ev++sL+yad+gl+vek++d+eapLL+s+dG+ef+s dr +kll+Gr+sfklkisqLsskc+nrLf ikfe+pk k y+fl
  Lus10013716 232 LDVVLLNAINQSINKELEVISSLIYADNGLPVEKTSDDEAPLLTSFDGIEFPSCDRTSKLLNGRTSFKLKISQLSSKCENRLFYIKFELPKYKGYRFL 329
                  8************************************************************************************************* PP

         STAT  99 eavskpirCisrsrntrssslt 120
                  ea+s+pirCisr+r  r++s+t
  Lus10013716 330 EAFSHPIRCISRNRYPRPLSAT 351
                  *****************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.505.101.1E-5601667IPR000980SH2 domain
SuperFamilySSF555501.72E-9602697IPR000980SH2 domain
PROSITE profilePS500019.025608665IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 705 aa     Download sequence    Send to blast
MGYDTIKNED YTSLKEFRVD IEVAKGEEEN EAERKFSVCF WLYLVKSCSS VSYPAPIINQ  60
VGSDVDFIAP FLFLNERRIM MIRPLCLVRK DSPPHTDSDS SLETPHASMA NEFPLEKWVH  120
VGCEVSANVL HLHINGENLV ELCFQLPSMT QSNSDGLKTI TLVGPSMDNC LQGYVHSAQV  180
SHISSSVRDC YFKDPPLQLS IDNSSTIEIE EDNDGIWSIV GGKASCRRIF SLDVVLLNAI  240
NQSINKELEV ISSLIYADNG LPVEKTSDDE APLLTSFDGI EFPSCDRTSK LLNGRTSFKL  300
KISQLSSKCE NRLFYIKFEL PKYKGYRFLE AFSHPIRCIS RNRYPRPLSA TLRRPTSAQY  360
SLSECPSIAS DNGSLELHNS LHEGDATPSS KRFKLVQEQT SAAPQMEEER HSQGFAANQA  420
EAMELVEAGN SPSESESTEE RISDYNIESN TQYSIPDPMI FKYCLGSSTD RALLMKDVST  480
SASDEELFRF ADKVSLYSGC AHHRHSIVIG KKLIEEGTRL WNSITQQNHP ARWGNIVFEI  540
EKQFMKIASC STRSLVEQDY DLLRRIAGCR EYMAQENFEK MWCWLYPVAC TLSRGWVNSL  600
WKCSSPKWIE GFITKEEAEL SLRGARGLQE PGTFILRFPT SRCWPHPDAG GLVVTYVGSD  660
YSIHHRLLSF EYINSSNERQ RSVKQVQEML LAEPELCRLG RQAS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10013716
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021661875.10.0uncharacterized protein LOC110651007
TrEMBLA0A251L8A00.0A0A251L8A0_MANES; Uncharacterized protein
STRINGLus100137160.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67103036
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17040.10.0SH2 domain protein A