PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10012782
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family SBP
Protein Properties Length: 794aa    MW: 88190.2 Da    PI: 6.8874
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10012782genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP115.33.4e-36133209177
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                  +Cqv+gCe+d++e+k yhrrh+vC  +++a++v ++g+++r+CqqC++fh l +fDe+krsCrr+L++hn+rrr+k+
  Lus10012782 133 RCQVPGCEVDITELKGYHRRHRVCLRCANATAVKIDGETKRYCQQCGKFHLLPDFDEGKRSCRRKLERHNNRRRRKS 209
                  6*************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.1E-28128195IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.427131208IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.23E-33132211IPR004333Transcription factor, SBP-box
PfamPF031104.2E-27134208IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055070Biological Processcopper ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 794 aa     Download sequence    Send to blast
MEPPSPPPSA PLDDRMESLH RHPPVTESYP PSSSSPGAWE LSDLLDFNID DHFPLPFDSL  60
DLPDDNPDTY FSPHDNPPTE RVRKRDPRST CSNFLAGRVP CACPELDEKL EQEEGVPGKK  120
RARVARGGPG MYRCQVPGCE VDITELKGYH RRHRVCLRCA NATAVKIDGE TKRYCQQCGK  180
FHLLPDFDEG KRSCRRKLER HNNRRRRKSV NGNVPANEGT SMDNLQAEDA ACNGETEKDG  240
LSFQIVGKEA LLEIEDGPGF QSESQKVNSD SGAASAETLF DAGNDDSGGK YDSKFSRSPS  300
NFDNRTAYSS LCPTGRVSFK LYDWNPAEFP RRLRHQIFQW LASMPVELEA YVRPGCTNLT  360
VFAAMPTRMW AKLLEDPLSH VQKFVLAPGS MLSGKGRMIV YLDNLMFRVL KGGTSVMQLN  420
VGTQSPRLHY VHPNCFEAGK PMEFVACGSN LFQSNFRLLV SFDGKYLAYD SCVGLPSGGV  480
DGNASRDHQL CKISIPHVDP NIFGPAFIEV ENGSGLSNFI PVLVGDRQIC SEMEVIQQRL  540
EVLNSATGFH CEISQTRQRI LSELIVDVAW LLKAPSQDRI RQTASSLQIQ RFVSMLQFLI  600
QHDSTFILGK VLSNLKIIVG AISLENVING NMDADAKLLK QYMDEASRFL HQKANRSNGL  660
AFVPEHSSSQ KCDVDKCCPR TDFRLFAALS DEDMENRLNN SLRLSEGSSP DVRSDEMPLL  720
NNGDVVMDVK LVKERPGKSC SVILSNRVLK SRAAMFVIPT VAVCVGVCAV LLHPNSVGKM  780
VVSIRSCWTE SRY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A2e-40133211583squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1194206RRKLERHNNRRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00604PBMTransfer from AT5G18830Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10012782
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021607121.10.0squamosa promoter-binding-like protein 7
TrEMBLA0A2C9WAE20.0A0A2C9WAE2_MANES; Uncharacterized protein
STRINGLus100127820.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF64703450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.30.0squamosa promoter binding protein-like 7