PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10012020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family SBP
Protein Properties Length: 482aa    MW: 52476.4 Da    PI: 8.5356
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10012020genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP135.81.3e-4266142177
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                  +CqvegC +dls+ak y++rhkvC +hsk+++v+v+gl+qrfCqqCsrfh l efD++krsCrrrLa+hnerrrk++
  Lus10012020  66 RCQVEGCGVDLSDAKGYYSRHKVCGAHSKTSTVVVNGLQQRFCQQCSRFHLLAEFDQGKRSCRRRLAGHNERRRKPS 142
                  6**************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.2E-3459128IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.31764141IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.62E-4165146IPR004333Transcription factor, SBP-box
PfamPF031103.3E-3267140IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 482 aa     Download sequence    Send to blast
MDIGGSGAAS SHSEFNNNNN INGLKFGKKI YFGDHMGLLS TTQPPQPPTT KPSRQQNQNQ  60
QQQIPRCQVE GCGVDLSDAK GYYSRHKVCG AHSKTSTVVV NGLQQRFCQQ CSRFHLLAEF  120
DQGKRSCRRR LAGHNERRRK PSPGSMLSPR YGRLSSSFFD NSISSRNGGG FLLDFSAFPK  180
SSSRNDIPAW QNNTNCSSQN PPPPNLYPGE CYNTGVSFVD SSCALSLLSN EQQWSSSTTP  240
TRAPIATTAT ITATSYPTTW GTANGTLMHQ SDYIGLGHTG SQLSAHLNME DHSSRPYGSS  300
SDHQQHINWK PSPGSLLSPR YGRLSSSFFD NSISSRNGGG FLLDFSAFPK SSSRNDIPAW  360
QNNTNCSSQN PPPPNLYPGE CYNTGVSFVD SSCALSLLSN EQQWSSSTTT TRAPIATTTT  420
ITTTSYPTTW STSNGTLMHH SDYIGLGHTG SQLSAHLNME DHSSRPYGSS SDHQQHINWS  480
L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-30671401184squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10012020
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKX0345570.0KX034557.1 Linum usitatissimum clone 139G15_FAD2A_M5791_Scaffold931 genomic sequence, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011033246.16e-75PREDICTED: squamosa promoter-binding-like protein 9
TrEMBLA0A165G0V40.0A0A165G0V4_LINUS; Sbp domain-DNA binding
STRINGLus100120200.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42083359
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.18e-48squamosa promoter binding protein-like 9