PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10011356
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family SBP
Protein Properties Length: 394aa    MW: 43795.5 Da    PI: 7.3918
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10011356genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.89.7e-41136212278
                  -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  CqvegC+ dls ak+yhr+h+vCe hsk+p+v+v+gle+rfCqqCsrfh+l efDe+krsCr+rL++hn+rrrk+q 
  Lus10011356 136 CQVEGCNLDLSGAKDYHRKHRVCEGHSKCPKVVVAGLERRFCQQCSRFHSLFEFDEKKRSCRKRLSDHNARRRKPQG 212
                  **************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.8E-32129197IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.992133210IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.32E-38134215IPR004333Transcription factor, SBP-box
PfamPF031109.0E-31136209IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MEWNPKPNLQ WDWENLIMYN DNSNPRKLDD DEEEEEGADW EIAEEKGTPV IHAGSFSSKS  60
ASTTSSQTQT PPKMTGYSSE PLLGLKLGKR TYFEDSSCVS NSIKVASGTS VPVNAAAAST  120
TMKRSRSSSS GVPVYCQVEG CNLDLSGAKD YHRKHRVCEG HSKCPKVVVA GLERRFCQQC  180
SRFHSLFEFD EKKRSCRKRL SDHNARRRKP QGESLRFNPS RLHSSIYDER QRMNYGWDTR  240
SPLIHGRPGN HLFWDDSSGS KFTITKECPS NIPIHHHLLG NQPACTQGVE VVHSTVSLNP  300
GGDDGTQDLQ RALSLLSTNS SSWGSCEQPS TITSLDTVHA TSTGFPQPLS GMPLQSVDAQ  360
MRSFTPSQAD NSQHHQQMLK GPQYSAEFYH CQL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-27127209384squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1191208KKRSCRKRLSDHNARRRK
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10011356
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015572189.18e-98squamosa promoter-binding-like protein 2
RefseqXP_015572190.18e-98squamosa promoter-binding-like protein 2
RefseqXP_025012387.18e-98squamosa promoter-binding-like protein 2
TrEMBLB9RMD62e-96B9RMD6_RICCO; LIGULELESS1 protein, putative
STRINGLus100113560.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46303058
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.33e-54squamosa promoter binding protein-like 2