PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10010100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB_related
Protein Properties Length: 715aa    MW: 78637.2 Da    PI: 6.341
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10010100genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.81.7e-152468147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
      Lus10010100 24 RERWTVEEHNRFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.26E-161874IPR009057Homeodomain-like
PROSITE profilePS5129419.5351973IPR017930Myb domain
TIGRFAMsTIGR015578.9E-162271IPR006447Myb domain, plants
SMARTSM007172.9E-122371IPR001005SANT/Myb domain
PfamPF002491.3E-122467IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-82464IPR009057Homeodomain-like
CDDcd001675.56E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 715 aa     Download sequence    Send to blast
MDTNSSGEEL FIKTRKPYTI TKQRERWTVE EHNRFLEALK LYGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFT KLEKEAVAKG VPIGQALDID IPPPRPKRKP SNPYPRKTGV SSITSKDGKV  120
SVSLPVPRNQ QVLDLETEPP PEKSSVDEKS TGAKGIHDDS CSQVFTSSSS VYSLKKYPTP  180
QQQGPTSPGS FREFVPRLKD VVSQDAPNEL HFTTEFDENT LQLDNSYHLH DNIQQGKKAD  240
DHTNILPGDK MQSMQNFPEH IPVKILDRKT CTQNSPPDVL RHKSMVPGGE SQAQSTVYSL  300
LTTSAAEIQN NFPASSHQSF PPLVRSQDEY KSFLQMSSTF SSLVVSTLLQ NPAAHAAASF  360
AASFWPFANV GNAADSTACT KEGFSSREIN SAPSMAAIAT ATVAAATAWW AAHGLLPMCA  420
PLQTAFPCPP ATTVPRDARM ASKEVNLEDP PLNHEWTEPE HLEAAQVQNS SSKLSDKYSP  480
ECEENGGLKP NSTPKVTDQE TNATPPEVHD CNKSKNRKQV DRSSCGSNTA SSSEVETDAL  540
EKNEKDEEKT KEAETNPLAP ADSRRSRSNN GSTSDSWKSV SEEGRLAFRA LFSREVLPQS  600
FSPPPKGEGE NGHHEEDNDE VQMPYVDRRN GDSEVLDLNS SKTWCQEGAE KNPYLPSCFS  660
AVGVGNGKLK GRRTGFKPYK RCSVEAKENR SCSCQGEEKE SKRICLGLEP EAST*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00119DAPTransfer from AT1G01060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10010100
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012083087.10.0protein LHY isoform X2
TrEMBLA0A067JWZ40.0A0A067JWZ4_JATCU; Uncharacterized protein
TrEMBLB7X9P10.0B7X9P1_POPNI; PnLHY1 protein
STRINGLus100101000.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48602537
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.32e-86MYB_related family protein