PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10010071
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family SBP
Protein Properties Length: 862aa    MW: 94043.2 Da    PI: 5.858
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10010071genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.51.4e-41146223178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +Cqve+C adls+ak+yhrrhkvCe+hska+++lv++++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  Lus10010071 146 ACQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVANVMQRFCQQCSRFHVLQEFDEGKRSCRRRLAGHNKRRRKTNP 223
                  5**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.3E-33139208IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.129144221IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.88E-38146225IPR004333Transcription factor, SBP-box
PfamPF031107.0E-30147220IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 862 aa     Download sequence    Send to blast
MEARFGTETA HFYGMSAMGM RTVGKGSLEW DLNDWKWDGD LFIASPLNSV PNSAAMSKQF  60
FPLATTGNSS NSSSSCSDEV HLELEKGRRE SEKRRRVIDL EEGNSNNDQE AGTLSLKIGG  120
HGGNWEGHSG KKTKLSGGSS SSSRAACQVE DCGADLSKAK DYHRRHKVCE MHSKATKALV  180
ANVMQRFCQQ CSRFHVLQEF DEGKRSCRRR LAGHNKRRRK TNPESGTTTN NVNDDQTGGY  240
LLISLLKTLS NMHSNKSDQT TEQDLLSHLL RGLAGHTIEQ GGRNISGILQ EPQELLNNGS  300
LLGIPKQQAQ LVRANGASMQ TSSSMKSRMT NNYPACSEVR ESNPGHMKMN NFDLNDAYID  360
SDDGTEDAER SPVPTNGGTS SLGCPSWAQQ DSQQSSPPQT SGNSDSTSPQ SPASSSGDAQ  420
CRTDRIVLKL FGKEPSDFPL VVRAQILDWL SHSPTDIESY IRPGCIVLTI YLRQDEAAWD  480
ELCCDLSNSL SRLLHASHDS FWSTGWIFVM VEHQIAFACD GQIVLDTSSP LRSIDCSSIF  540
SIKPIAVPAT VKVQFLVKGT NLSRPTTRMM CAIEGKYLVQ EEDSDDLVDA TGQGQLQCVP  600
FSCSIPTGHG RGFIEIEEHG ISNSFFPFIV AEEDVCSEIR TLEDALEFIE TDDDLGEGGR  660
VEAKNKAMEF IHEMDMAGPG GLTPLHIAAG KDGSEDVLDA LTNDSQMVGV EAWKKARDST  720
GFTPEDYARL RGHYSYIHLV QRKINSRKSS GSSHVVLDIP GGQETSPNQK QNEALSLALE  780
IAQTMSKPAG GGSSSNCNLC SRKVAYGVSS SRRSLLYRPA MLSMVAVAAV CVCVALLFKS  840
CPEVVYVLSP FRWEMLEFGT S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-31137220184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19296KRRRV
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000269|PubMed:16554053}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10010071
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021676158.10.0squamosa promoter-binding-like protein 1 isoform X3
SwissprotQ9S7P50.0SPL12_ARATH; Squamosa promoter-binding-like protein 12
TrEMBLA0A0B0MYY20.0A0A0B0MYY2_GOSAR; Squamosa promoter-binding-like protein 1
STRINGLus100100710.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15393495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1
Publications ? help Back to Top
  1. Jung S, et al.
    Synteny conservation between the Prunus genome and both the present and ancestral Arabidopsis genomes.
    BMC Genomics, 2006. 7: p. 81
    [PMID:16615871]
  2. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  3. Chao LM, et al.
    Arabidopsis Transcription Factors SPL1 and SPL12 Confer Plant Thermotolerance at Reproductive Stage.
    Mol Plant, 2017. 10(5): p. 735-748
    [PMID:28400323]