PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10009816
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family HB-other
Protein Properties Length: 932aa    MW: 102338 Da    PI: 6.2605
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10009816genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox21.63.6e-0769125157
                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
     Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                  +r+R  ++++ ++ ++++F  +  +s++e ++++++ ++t +qV+ +F  +R + ++
  Lus10009816  69 KRPRDLLNPKAIKYMQAVFSIKDAISKKESRQISAQFSITVTQVREFFTSQRSRVRR 125
                  799**************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.00966126IPR001356Homeobox domain
SuperFamilySSF466893.94E-667129IPR009057Homeodomain-like
SMARTSM003893.0E-468130IPR001356Homeobox domain
PfamPF000461.4E-469125IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.0E-669128IPR009057Homeodomain-like
CDDcd000860.0046969116No hitNo description
SuperFamilySSF476762.22E-5294384IPR017923Transcription factor IIS, N-terminal
Gene3DG3DSA:1.20.930.104.4E-5294381IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 932 aa     Download sequence    Send to blast
MAGLKEDFAE MEIGTTAASF QRFMDSQKDL FHSQVDQLQR IVVTQCKLTG VNPLSQEMAA  60
GALSINIGKR PRDLLNPKAI KYMQAVFSIK DAISKKESRQ ISAQFSITVT QVREFFTSQR  120
SRVRRLVRLA RENGIQANSL KEPENNLQIE GIPRGSNSVS LSLIVPDMVP ASSNGPPDVT  180
SSTVCPYTAP LQSVGPNSVP LTAANLNPEI LTSVGSDYIP LNCITPYSEP LLSAGPANCE  240
GGQSFSKQEE ILPGLDDSEK HFVETIFGLL KREETFGGQV KLMEWVLQIQ NLTVLYWFLT  300
EGGVMILATW LTQAAAEEQT SVLLVALRVL CHLPLHNAFP EHMSAILHSV NTLRFYRTSD  360
ISSRARILLA KWTKLFARSQ SLRKPNGVGS SIDAQDMILK KSIDEIMSNG FSQTDIGHTE  420
GSLAFPSGNS ENVRRMESSQ TMKLLPASSD DSSRKHILGS PSLADTRERR KVQLVEQPGQ  480
KPSSRSPQGA KSGSISQGRP MSADDIQKAK MRALYMQSKY GRKSNLSNGS NSIKNGVVDK  540
MPTVSIGSSS QVSKVLAKLK REEPNEPVIA AAPMSICMGE HLDNTMLQVE SQVVSKALAE  600
PKNEEPKEPV IDAAPMSICK IEHPDTIMLN VESTAFSKAH AEPKDEEVKE PVVSTPKSTY  660
KDEHQHATEQ KVALKVPIKQ ICSRPQIRWH SPTEVKLDVE WRVGTGEFSK EVEVQRNRNR  720
REMETIYRDV KKIPSNPKEP WDLDMDYDDS LTPEIPIEQQ PDADGTDTQI PDNQLENPVA  780
GAPTIVNGGV AAVAEPDLEL LAVLLKNPEL VFALTSGQAG NLSSDDTMRL LEMMKTGGIA  840
LGNSVNESDG KVGEVSLPSP TPSSNNPRTV RDSGLPCCCK FCHKSLNPHL DFPGEQLFAV  900
YMVVVVLIFI EKNDNSIESK AFFHHPWPVF G*
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10009816
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011470994.10.0PREDICTED: homeobox protein LUMINIDEPENDENS
TrEMBLA0A067HH030.0A0A067HH03_CITSI; Uncharacterized protein
STRINGLus100098160.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98092934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.21e-144HB-other family protein