PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10009669
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NAC
Protein Properties Length: 344aa    MW: 39153.6 Da    PI: 7.071
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10009669genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.13.9e-5451331129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  lppGfrFhPtd+el+++yL++kv+++++++ ++i ++d++k ePwdLp k++ +ekewyfFs rd+ky+tg r+nrat++gyWk+tgkdke++s+  g
  Lus10009669   5 LPPGFRFHPTDDELISFYLTRKVSDTRFDC-KAIVDADLNKNEPWDLPGKASMGEKEWYFFSLRDRKYPTGLRTNRATEAGYWKTTGKDKEIFSAtAG 101
                  79****************************.88***************988999***************************************99788 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrle 129
                  +lvg+kktLvfy+grap+gek++Wvmheyrle
  Lus10009669 102 TLVGMKKTLVFYRGRAPRGEKSNWVMHEYRLE 133
                  89****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-633153IPR003441NAC domain
PROSITE profilePS5100560.7015153IPR003441NAC domain
PfamPF023659.7E-296132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MEENLPPGFR FHPTDDELIS FYLTRKVSDT RFDCKAIVDA DLNKNEPWDL PGKASMGEKE  60
WYFFSLRDRK YPTGLRTNRA TEAGYWKTTG KDKEIFSATA GTLVGMKKTL VFYRGRAPRG  120
EKSNWVMHEY RLENKHRYKS IKEEWVVCRV FQKSVSALKK PQQESSSQGS PCDTNFVTNN  180
NEFGDMEFPN HIKATHTFSS GLLFNDISTY NNNIMIDHDI PNNNNLNNNN NIVHMNMNQG  240
QPSLLPWPTS NLLTSNLTMN SLLLKALQLR SYQQHQEASS SVETNVDYSM LSNQQQQQQL  300
LQQDQLGSSF QGSSASSTSR APEMAVQHAP SESGHLFNTD SIW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-56415916171NO APICAL MERISTEM PROTEIN
1ut4_B5e-56415916171NO APICAL MERISTEM PROTEIN
1ut7_A5e-56415916171NO APICAL MERISTEM PROTEIN
1ut7_B5e-56415916171NO APICAL MERISTEM PROTEIN
3swm_A5e-56415919174NAC domain-containing protein 19
3swm_B5e-56415919174NAC domain-containing protein 19
3swm_C5e-56415919174NAC domain-containing protein 19
3swm_D5e-56415919174NAC domain-containing protein 19
3swp_A5e-56415919174NAC domain-containing protein 19
3swp_B5e-56415919174NAC domain-containing protein 19
3swp_C5e-56415919174NAC domain-containing protein 19
3swp_D5e-56415919174NAC domain-containing protein 19
4dul_A5e-56415916171NAC domain-containing protein 19
4dul_B5e-56415916171NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10009669
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002321475.21e-132NAC domain-containing protein 92
RefseqXP_011009316.11e-132PREDICTED: NAC domain-containing protein 100-like
TrEMBLB9IE381e-130B9IE38_POPTR; Uncharacterized protein
STRINGLus100096690.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49463356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.12e-95NAC domain containing protein 58