PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10009472
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MIKC_MADS
Protein Properties Length: 172aa    MW: 18869.8 Da    PI: 8.6347
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10009472genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF79.22.9e-25957149
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                 krien   rqvtf+kRr+g+lKKA+ELSvLCdae+ v++fss+gk ye 
  Lus10009472  9 KRIENPVHRQVTFCKRRAGLLKKAKELSVLCDAEIGVLVFSSHGKHYEL 57
                 79*******************************************9996 PP

2K-box40.89.7e-15961601074
        K-box  10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnelll 74 
                  ++  +++ ++e++ Lk+ei++Lq+ +R + G + ++++l+eL  Le++Le  + +iRs+K+e +l
  Lus10009472  96 SKDPNQNAKEEINMLKQEIQMLQKGLRYMFGGGDSEMTLEELLVLEKHLEIWVCQIRSTKSEAIL 160
                  556689*******************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.44E-28175IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.436161IPR002100Transcription factor, MADS-box
SMARTSM004322.8E-35160IPR002100Transcription factor, MADS-box
CDDcd002654.19E-39273No hitNo description
PRINTSPR004041.7E-26323IPR002100Transcription factor, MADS-box
PfamPF003194.1E-231056IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-263859IPR002100Transcription factor, MADS-box
PfamPF014861.1E-1396160IPR002487Transcription factor, K-box
PROSITE profilePS512979.291100171IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MARGKVQMKR IENPVHRQVT FCKRRAGLLK KAKELSVLCD AEIGVLVFSS HGKHYELATK  60
GTMQGLIDKY MKCSPGSGSG SSSGSDSGAA QPVVESKDPN QNAKEEINML KQEIQMLQKG  120
LRYMFGGGDS EMTLEELLVL EKHLEIWVCQ IRSTKSEAIL TGHVVSFEVN N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A2e-15184183MEF2 CHIMERA
6byy_B2e-15184183MEF2 CHIMERA
6byy_C2e-15184183MEF2 CHIMERA
6byy_D2e-15184183MEF2 CHIMERA
6bz1_A2e-15183182MEF2 CHIMERA
6bz1_B2e-15183182MEF2 CHIMERA
6bz1_C2e-15183182MEF2 CHIMERA
6bz1_D2e-15183182MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription activator that regulates root development by controlling cell proliferation in root meristem. May mediate responses to auxin in the root. May act as promoter of the flowering transition through up-regulation of SOC, FT and LFY. {ECO:0000269|PubMed:18203871}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10009472
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin in root phloem. {ECO:0000269|PubMed:18203871}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006376144.27e-74agamous-like MADS-box protein AGL12 isoform X1
RefseqXP_024439180.16e-74agamous-like MADS-box protein AGL12 isoform X2
SwissprotQ388413e-66AGL12_ARATH; Agamous-like MADS-box protein AGL12
TrEMBLA0A218W4Q43e-75A0A218W4Q4_PUNGR; Uncharacterized protein
STRINGLus100094721e-124(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF75663144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.13e-63AGAMOUS-like 12
Publications ? help Back to Top
  1. Zimmermann P,Hirsch-Hoffmann M,Hennig L,Gruissem W
    GENEVESTIGATOR. Arabidopsis microarray database and analysis toolbox.
    Plant Physiol., 2004. 136(1): p. 2621-32
    [PMID:15375207]
  2. Pacheco-Escobedo MA, et al.
    Longitudinal zonation pattern in Arabidopsis root tip defined by a multiple structural change algorithm.
    Ann. Bot., 2018.
    [PMID:27358290]
  3. GarcĂ­a-Cruz KV, et al.
    The MADS-box XAANTAL1 increases proliferation at the Arabidopsis root stem-cell niche and participates in transition to differentiation by regulating cell-cycle components.
    Ann. Bot., 2018.
    [PMID:27474508]