PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10008419
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NAC
Protein Properties Length: 451aa    MW: 51793.8 Da    PI: 8.0461
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10008419genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.82.6e-5031282128
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                  +pGfrFhPt+eelv +yL++kvegk++++ e i+ +d+y+++Pw+Lp++++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ + +++++ 
  Lus10008419   3 MPGFRFHPTEEELVEFYLRRKVEGKRFNV-ELITFLDLYRFDPWELPAMAAIGEKEWFFYVPRDRKYRNGDRPNRVTTSGYWKATGADRMIRTENSRS 99 
                  79***************************.89***************888889********************************************* PP

          NAM 100 vglkktLvfykgrapkgektdWvmheyrl 128
                  +glkktLvfy+g+apkg +t+W+m+eyrl
  Lus10008419 100 IGLKKTLVFYSGKAPKGIRTSWIMNEYRL 128
                  ***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100555.8042149IPR003441NAC domain
SuperFamilySSF1019416.15E-563148IPR003441NAC domain
PfamPF023656.8E-254128IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MVMPGFRFHP TEEELVEFYL RRKVEGKRFN VELITFLDLY RFDPWELPAM AAIGEKEWFF  60
YVPRDRKYRN GDRPNRVTTS GYWKATGADR MIRTENSRSI GLKKTLVFYS GKAPKGIRTS  120
WIMNEYRLPH HDTQRYQKTE ISLCRVYKRA GVEDHHGGPS SLPRTLPSSI NRPHHYQHQN  180
HMGASSSSSK KHQRIHQEQE QQHQHLLQPS EQQQHHHQLL QLQPFSTQVM MLMDVDKLTN  240
ASTSTSTTCT ATAIGTSTDS NLAAAGLISN TTSLGLLPPT LGPDHHSRLL PIHHHHRQED  300
EEQLMLLLNR GGGPSDQPSS SSNMNNSNTT LPAGLDDLQR LVNYQQHQQQ YYTRLLQHHQ  360
QQNDDPQPHQ VLQQMMIFPP TTPSPQQIVL PTTSLPTINN RSSSSSLNIW DWNLLPPPPP  420
QHQHHQSDDQ NHHPPPPHYD TNNDDINPFK *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-56414919165NO APICAL MERISTEM PROTEIN
1ut4_B4e-56414919165NO APICAL MERISTEM PROTEIN
1ut7_A4e-56414919165NO APICAL MERISTEM PROTEIN
1ut7_B4e-56414919165NO APICAL MERISTEM PROTEIN
3swm_A5e-56414922168NAC domain-containing protein 19
3swm_B5e-56414922168NAC domain-containing protein 19
3swm_C5e-56414922168NAC domain-containing protein 19
3swm_D5e-56414922168NAC domain-containing protein 19
3swp_A5e-56414922168NAC domain-containing protein 19
3swp_B5e-56414922168NAC domain-containing protein 19
3swp_C5e-56414922168NAC domain-containing protein 19
3swp_D5e-56414922168NAC domain-containing protein 19
4dul_A4e-56414919165NAC domain-containing protein 19
4dul_B4e-56414919165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10008419
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003550460.11e-124NAC domain-containing protein 35
RefseqXP_028209593.11e-124NAC domain-containing protein 35-like
TrEMBLA0A445FZS31e-123A0A445FZS3_GLYSO; NAC domain-containing protein 35 isoform A
TrEMBLA0A445FZS91e-122A0A445FZS9_GLYSO; NAC domain-containing protein 35 isoform B
TrEMBLK7MJ701e-123K7MJ70_SOYBN; Uncharacterized protein
STRINGLus100084190.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72033146
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.11e-108NAC domain containing protein 35