PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10007984
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family SBP
Protein Properties Length: 517aa    MW: 56457.7 Da    PI: 7.7655
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10007984genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.61.1e-40173249278
                  -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  Cqv gC++dls+ keyh+rhkvC+vhsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q 
  Lus10007984 173 CQVYGCNKDLSSSKEYHKRHKVCDVHSKTAKVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKHQV 249
                  **************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.9E-33166234IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.035170247IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.71E-38171250IPR004333Transcription factor, SBP-box
PfamPF031105.3E-31173246IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 517 aa     Download sequence    Send to blast
MEYSSYGSKG STAAFVSNET TMSSSSSDTS TRSRTGSLLD WDLRRALVSS APFVENQSFG  60
EMWGYCHHEV VAKALPLPHG SVRYHLNSKG ETEECIKNPF VVNSSALCLK DESSSRLSIS  120
SSVVEYSTNS SKDHSSASFI DLKLGRVGDP SKLYTPPKRA RFGGANSNAA AHCQVYGCNK  180
DLSSSKEYHK RHKVCDVHSK TAKVIVNGIE QRFCQQCSRF HLLAEFDDGK RSCRKRLAGH  240
NERRRKHQVR IHSGRAARLI QAYNGFPSGR IQETGLTSSF ICQDILPGTL LYSERYGANE  300
YSSRRVKHED QESTLSPNLS GISVLEQPLY PFEKMFPAFR DGVVTTPSGS IFSENNNRYP  360
LDAGGSNSSS HCLVPQGTSS LGNDEFITLD AAASPTIQGL SGVTIADSSS TGCALSLLSS  420
QSQSSSSSQS SQIPMAGHHY GMNQQQQVSG RMIRFGLATE ASHLMSPLLL SHLEDHNTNG  480
EDTTTIDLLQ LSSQLHRVEN EKQKSLQQDA AEVYLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-29163246184squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10007984
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021665393.11e-122squamosa promoter-binding-like protein 6 isoform X4
TrEMBLA0A067K5H81e-122A0A067K5H8_JATCU; Uncharacterized protein
STRINGLus100079840.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.11e-45SBP family protein