PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10007983
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MIKC_MADS
Protein Properties Length: 266aa    MW: 30042.9 Da    PI: 8.7539
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10007983genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF95.62.2e-301059251
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 rienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+i+fs++gkl+eys+
  Lus10007983 10 RIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYST 59
                 8***********************************************96 PP

2K-box102.84.4e-34791745100
        K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                  +  ++++++  s++ e+akLk++ie Lq+++R++ G+dL+sLsl+eLq+LeqqL+++lk+iRs+Kn+l++e+i+elqkk k+lq++n++L kk++e
  Lus10007983  79 QLLANDTETCGSWTLEYAKLKARIEVLQKNLRNYNGQDLDSLSLRELQNLEQQLDSALKHIRSRKNQLMYESISELQKKDKALQDQNNQLAKKVKE 174
                  555567778899*********************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.394161IPR002100Transcription factor, MADS-box
SMARTSM004322.0E-39160IPR002100Transcription factor, MADS-box
CDDcd002651.36E-41279No hitNo description
SuperFamilySSF554551.31E-33288IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-31323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.8E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-313859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129716.67788178IPR002487Transcription factor, K-box
PfamPF014861.8E-2790172IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010154Biological Processfruit development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MGRGRVQLRR IENKINRQVT FSKRRSGLLK KAHEISVLCD AEVALIVFST KGKLFEYSTD  60
SCMERILERY ERYSYAERQL LANDTETCGS WTLEYAKLKA RIEVLQKNLR NYNGQDLDSL  120
SLRELQNLEQ QLDSALKHIR SRKNQLMYES ISELQKKDKA LQDQNNQLAK KVKEREKEIL  180
EQPQWEQQQD PPSLVTQQME DSPSSIVVAP QPFQPLDISG GSGGGGGGGY QLARGNTGVE  240
EGTSSSSSQH RPSAVLPSWM MGNHI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P6e-22174173Myocyte-specific enhancer factor 2B
1tqe_Q6e-22174173Myocyte-specific enhancer factor 2B
1tqe_R6e-22174173Myocyte-specific enhancer factor 2B
1tqe_S6e-22174173Myocyte-specific enhancer factor 2B
5f28_C7e-22174173MEF2C
5f28_D7e-22174173MEF2C
6byy_A6e-22174173MEF2 CHIMERA
6byy_B6e-22174173MEF2 CHIMERA
6byy_C6e-22174173MEF2 CHIMERA
6byy_D6e-22174173MEF2 CHIMERA
6bz1_A7e-22174173MEF2 CHIMERA
6bz1_B7e-22174173MEF2 CHIMERA
6bz1_C7e-22174173MEF2 CHIMERA
6bz1_D7e-22174173MEF2 CHIMERA
6c9l_A6e-22174173Myocyte-specific enhancer factor 2B
6c9l_B6e-22174173Myocyte-specific enhancer factor 2B
6c9l_C6e-22174173Myocyte-specific enhancer factor 2B
6c9l_D6e-22174173Myocyte-specific enhancer factor 2B
6c9l_E6e-22174173Myocyte-specific enhancer factor 2B
6c9l_F6e-22174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10007983
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008393256.11e-120truncated transcription factor CAULIFLOWER A-like isoform X1
SwissprotQ424291e-111AGL8_SOLTU; Agamous-like MADS-box protein AGL8 homolog
TrEMBLA0A1S3YGF61e-119A0A1S3YGF6_TOBAC; agamous-like MADS-box protein AGL8 homolog
TrEMBLQ283Q11e-119Q283Q1_MALDO; MdMads2.1 protein
STRINGLus100079830.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF58832119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60910.11e-100AGAMOUS-like 8
Publications ? help Back to Top
  1. Kang SG,Hannapel DJ
    Nucleotide sequences of novel potato (Solanum tuberosum L.) MADS-box cDNAs and their expression in vegetative organs.
    Gene, 1995. 166(2): p. 329-30
    [PMID:8543185]