PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10007914
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB_related
Protein Properties Length: 354aa    MW: 38538 Da    PI: 7.0252
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10007914genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.31.8e-1380124147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
      Lus10007914  80 RESWTEQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 124
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.12E-1674130IPR009057Homeodomain-like
PROSITE profilePS5129415.40875129IPR017930Myb domain
TIGRFAMsTIGR015571.6E-1878127IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.3E-678130IPR009057Homeodomain-like
SMARTSM007175.3E-1179127IPR001005SANT/Myb domain
PfamPF002493.0E-1180124IPR001005SANT/Myb domain
CDDcd001672.36E-882125No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MVSVNPNPAP GFFFFDSLEN PIDSPILPSG VRSLPPSSSS VAAAAAATDT ASTSANNNTL  60
SFGEDQSKKI RKPYTITKSR ESWTEQEHDK FLEALQLFDR DWKKIEAFVG SKTVIQIRSH  120
AQKYFLKVQK SGTSEHVPPP RPKRKAAHPY PQKAPKTAAP VVHQVTEVFP SPSASMENGY  180
VYQQPDSSSV LATPMSAGGA LSSWNYYPLP QASLSQVIPD ETANVGTTTA SNCCYSSSND  240
STPKTWQGHQ TVRRGDQNEA ARVMPDFAQV YSFIGSVFDP NASGHVEKLK QMDPINLETV  300
MLLMRNLSFN LTSPEFEDHQ RKVLASHDPA TERATGYGNI RSDETTGSAI PAV*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10007914
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021644126.11e-154protein REVEILLE 6-like isoform X1
SwissprotQ8H0W31e-100RVE6_ARATH; Protein REVEILLE 6
TrEMBLB9I8P31e-149B9I8P3_POPTR; Uncharacterized protein
STRINGLus100079140.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.27e-87MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]