PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10007100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MIKC_MADS
Protein Properties Length: 215aa    MW: 24506.1 Da    PI: 10.1205
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10007100genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.47.7e-281059251
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 ri++ +nrqvtfskRr+g++KKA+ELS+LCda++a+i+fs+t+kly +ss
  Lus10007100 10 RIDDRTNRQVTFSKRRTGLIKKAKELSILCDAQIALIVFSTTNKLYQFSS 59
                 8***********************************************96 PP

2K-box82.11.2e-2780170898
        K-box   8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                   + +++ + +q+e+akLk+e+++L + +R+l+Ge+++ Ls+++Lq+Le+qLe slk iR kK++ +++qi  l  k ++  een +L+k++
  Lus10007100  80 VNPASEIKFWQKEAAKLKRELQSLNEYHRQLMGEEVSGLSVRDLQNLETQLEISLKAIRLKKHNTMTDQITALTAKGNQCYEENIQLHKQF 170
                  3678899*********************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.9E-37160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.543161IPR002100Transcription factor, MADS-box
CDDcd002657.10E-40278No hitNo description
SuperFamilySSF554553.79E-31288IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-26323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003194.2E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-263859IPR002100Transcription factor, MADS-box
PfamPF014863.4E-2584170IPR002487Transcription factor, K-box
PROSITE profilePS5129713.56786176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010440Biological Processstomatal lineage progression
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MGRGKTVIRR IDDRTNRQVT FSKRRTGLIK KAKELSILCD AQIALIVFST TNKLYQFSST  60
SMMSIIDRYT RQKEAHSQPV NPASEIKFWQ KEAAKLKREL QSLNEYHRQL MGEEVSGLSV  120
RDLQNLETQL EISLKAIRLK KHNTMTDQIT ALTAKGNQCY EENIQLHKQF NFFANEKSAL  180
GIKVYEERNA EETDGMAKAA VSLQLTQPEP LKLG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A4e-25181181MEF2C
5f28_B4e-25181181MEF2C
5f28_C4e-25181181MEF2C
5f28_D4e-25181181MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
UniProtProbable transcription factor involved in the regulation of flowering time in long-day photoperiod. Participates in the repression of FT expression and floral transition, by interacting closely with the FLC-SVP pathways (PubMed:24876250). Functions in the satellite meristemoid lineage of stomatal development (PubMed:17704216). {ECO:0000269|PubMed:17704216, ECO:0000269|PubMed:24876250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00410DAPTransfer from AT3G57230Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10007100
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the micro RNA miR824. {ECO:0000269|PubMed:18579782}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021659606.11e-87MADS-box transcription factor 23-like isoform X1
RefseqXP_021659607.11e-87MADS-box transcription factor 23-like isoform X1
SwissprotA2RVQ56e-74AGL16_ARATH; Agamous-like MADS-box protein AGL16
SwissprotQ6EP497e-74MAD27_ORYSJ; MADS-box transcription factor 27
TrEMBLA0A2L0V2983e-86A0A2L0V298_HEVBR; MADS-box protein (Fragment)
STRINGLus100071001e-158(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF8912560
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.13e-76AGAMOUS-like 16
Publications ? help Back to Top
  1. Puig J, et al.
    Analysis of the expression of the AGL17-like clade of MADS-box transcription factors in rice.
    Gene Expr. Patterns, 2013 Jun-Jul. 13(5-6): p. 160-70
    [PMID:23466806]
  2. Yang K,Jiang M,Le J
    A new loss-of-function allele 28y reveals a role of ARGONAUTE1 in limiting asymmetric division of stomatal lineage ground cell.
    J Integr Plant Biol, 2014. 56(6): p. 539-49
    [PMID:24386951]
  3. Yu C, et al.
    The effects of fluctuations in the nutrient supply on the expression of five members of the AGL17 clade of MADS-box genes in rice.
    PLoS ONE, 2014. 9(8): p. e105597
    [PMID:25140876]