PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10006715
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MIKC_MADS
Protein Properties Length: 249aa    MW: 28462.5 Da    PI: 7.4634
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10006715genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.51.1e-30959151
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 krien + rqvtfskRrng+lKKA+ELSvLCdaeva+iifs++gklye+ss
  Lus10006715  9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSS 59
                 79***********************************************96 PP

2K-box71.52.5e-24931692197
        K-box  21 lakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                     ++k+ie+L+ ++R+l+Ge+Le +s  eL+++e qLe+sl++iR++Kn+l+++qi++l++ ek l eenk+Lr+k
  Lus10006715  93 GLSMEKKIEQLEISKRQLMGECLEACSTAELRKIECQLERSLSRIRARKNQLFMDQIDKLREEEKILLEENKKLREK 169
                  45789**********************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.31161IPR002100Transcription factor, MADS-box
SMARTSM004321.0E-41160IPR002100Transcription factor, MADS-box
CDDcd002652.64E-41271No hitNo description
SuperFamilySSF554554.32E-32372IPR002100Transcription factor, MADS-box
PRINTSPR004046.7E-31323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003196.4E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004046.7E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004046.7E-313859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129714.18286176IPR002487Transcription factor, K-box
PfamPF014862.1E-2493170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010048Biological Processvernalization response
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MARGKTQMKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVALIIFSP RGKLYEFSSS  60
SITKTIERYE KKHKDIGPGS KEFEDNMIQD NDGLSMEKKI EQLEISKRQL MGECLEACST  120
AELRKIECQL ERSLSRIRAR KNQLFMDQID KLREEEKILL EENKKLREKC GVEPSMKLSS  180
YSTKVKHHHH NQQLDIVVIA EEEDGDDDEE SMEVETELFI GLADPARRRS TAKANSTSPP  240
ARIMTPTP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A6e-19169169MEF2C
5f28_B6e-19169169MEF2C
5f28_C6e-19169169MEF2C
5f28_D6e-19169169MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that promotes flowering, especially in response to vernalization by short periods of cold, in an FLC-inpedendent manner. {ECO:0000269|PubMed:16778081}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10006715
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Maintained at very low levels by the polycomb-group (PcG) proteins MSI1, CLF, and EMF2 via histone methylation (H3K27me3). Derepressed upon cold treatment (vernalization). {ECO:0000269|PubMed:16778081}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM1408478e-31HM140847.1 Oncidium Gower Ramsey MADS box transcription factor 11 (MADS11) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021686234.18e-87agamous-like MADS-box protein AGL19 isoform X4
RefseqXP_021686235.18e-87agamous-like MADS-box protein AGL19 isoform X4
RefseqXP_021686236.18e-87agamous-like MADS-box protein AGL19 isoform X4
SwissprotO827431e-72AGL19_ARATH; Agamous-like MADS-box protein AGL19
TrEMBLA0A2C9WBZ02e-85A0A2C9WBZ0_MANES; Uncharacterized protein
STRINGLus100067150.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66630102
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22950.12e-66AGAMOUS-like 19
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Suter L,Rüegg M,Zemp N,Hennig L,Widmer A
    Gene regulatory variation mediates flowering responses to vernalization along an altitudinal gradient in Arabidopsis.
    Plant Physiol., 2014. 166(4): p. 1928-42
    [PMID:25339407]