PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10006411
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family SBP
Protein Properties Length: 394aa    MW: 43816.4 Da    PI: 7.2414
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10006411genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.89.9e-41134210278
                  -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  CqvegC+ dls +k+yhr+h+vCe hsk+p+v+v+gle+rfCqqCsrfh+l efDe+krsCr+rL++hn+rrrk+q 
  Lus10006411 134 CQVEGCNLDLSGVKDYHRKHRVCESHSKCPKVVVAGLERRFCQQCSRFHSLFEFDEKKRSCRKRLSDHNARRRKPQG 210
                  **************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.5E-32127195IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.052131208IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.49E-38132213IPR004333Transcription factor, SBP-box
PfamPF031101.1E-30134207IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MEWNPKPNLQ WDWENLIMYN DNNNPRKLDD DEEEEGADWE IAEEKGTPVI HAGSFSSKPS  60
STTSSQTQTP PKTTGYSTEP LLGLKLGKRT YFEDSSCVSN SSKVASGASV PVNAAASTMM  120
KRSRSSSSGV PVYCQVEGCN LDLSGVKDYH RKHRVCESHS KCPKVVVAGL ERRFCQQCSR  180
FHSLFEFDEK KRSCRKRLSD HNARRRKPQG ESLRFSPSRL HSSIYDERQR MSYGWDTRSP  240
LVHGRPGNYL FWDDSSGSKF TITKECPSDI PTHHHHHLLG SQPASTQGVE VVESTVSLNP  300
GGDDATQDLQ RALSLLSTNS SSWGSCEQPS TITSLDTVHT TSAGFPQPLS GMPLQSVDAQ  360
MRSFTPSQAD NSQHHQQVLK GPQYSAEFYH CQL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-26125207384squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1189206KKRSCRKRLSDHNARRRK
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10006411
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021632695.11e-103squamosa promoter-binding-like protein 2
RefseqXP_021632696.11e-103squamosa promoter-binding-like protein 2
RefseqXP_021632697.11e-103squamosa promoter-binding-like protein 2
RefseqXP_021632698.11e-103squamosa promoter-binding-like protein 2
RefseqXP_021632699.11e-103squamosa promoter-binding-like protein 2
RefseqXP_021632700.11e-103squamosa promoter-binding-like protein 2
RefseqXP_021632701.11e-103squamosa promoter-binding-like protein 2
RefseqXP_021632702.11e-103squamosa promoter-binding-like protein 2
SwissprotA2YGR55e-64SPL12_ORYSI; Squamosa promoter-binding-like protein 12
TrEMBLA0A2C9UP381e-101A0A2C9UP38_MANES; Uncharacterized protein
STRINGLus100064110.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46303058
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.32e-51squamosa promoter binding protein-like 2