PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10005584
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family STAT
Protein Properties Length: 703aa    MW: 79361.8 Da    PI: 5.2257
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10005584genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT185.95e-582313501120
         STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfeipklkkypfl 98 
                  ldvvllna+ q+++k++ev++sL+yad+gl+vek++d+eapLL+s+dG+ef+s dr +kll+Gr+sfklkisqLsskc+nrLf ikfe++k k y+fl
  Lus10005584 231 LDVVLLNAINQSINKELEVISSLIYADNGLPVEKTSDDEAPLLTSFDGIEFPSCDRTSKLLNGRTSFKLKISQLSSKCENRLFYIKFELLKYKGYRFL 328
                  8************************************************************************************************* PP

         STAT  99 eavskpirCisrsrntrssslt 120
                  ea+ +pirCisr+r  r++s+t
  Lus10005584 329 EAFCHPIRCISRNRYPRPLSAT 350
                  *****************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF498995.98E-634193IPR013320Concanavalin A-like lectin/glucanase domain
Gene3DG3DSA:3.30.505.101.1E-5600666IPR000980SH2 domain
SuperFamilySSF555504.21E-9601694IPR000980SH2 domain
PROSITE profilePS500019.351607688IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 703 aa     Download sequence    Send to blast
MGDDTIKTED YTSLKEFRVD IDVAKGEEEN DAERKFSVCF WIYLVKSSSV SYPTPIINQV  60
GSDGDFVAPF LFLNERRIMM LRLLCPVRKD SPPHTDSASL LETPHASMAT EFPLEKWVHV  120
GCEVSATVLH LHINGENLVE LCFPLPSMTQ SNSDGLKTIT LVGPSIDNCL QGYVHDVQVS  180
HTSSSVRDCY FKDPPLQLCI DKSSTIEIEE DNDGIWSIVG GKASCRRIFS LDVVLLNAIN  240
QSINKELEVI SSLIYADNGL PVEKTSDDEA PLLTSFDGIE FPSCDRTSKL LNGRTSFKLK  300
ISQLSSKCEN RLFYIKFELL KYKGYRFLEA FCHPIRCISR NRYPRPLSAT LRRPTSTQYS  360
LSVCPSIASD NGSLELQNSL HEGDVTPSSK KFKLVDEQTS SAPQTEEEHH SQGFAANQAE  420
AMELVEEGNS PSELDSTEER ISDYNIESKT QYSIPDPMIF KYCLGSLTDR ALLMKEVSTS  480
ASDEELFRFA DKVSLYSGCA HHRNSIVIGK KLIEEGTRLW NSITQQNHPA RWENIAFEIE  540
KQFMKIASCS TRSLVEQDYD LLRRIAGCRE YMAQENFEKM WCWLYPVACT LSRGWVNSLW  600
KCSSPKWIEG FITKEEAELS LRGARGLQEP GTFILRFPTS RCWPHPDSGG LVVTYVGSDY  660
SIHHRLLSSE YINSNERQRS AKQVQEMILA EPELCRLGRQ AS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10005584
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021661875.10.0uncharacterized protein LOC110651007
TrEMBLA0A251L8A00.0A0A251L8A0_MANES; Uncharacterized protein
STRINGLus100055840.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67103036
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17040.10.0SH2 domain protein A