PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10005548
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family SBP
Protein Properties Length: 188aa    MW: 21273.5 Da    PI: 8.66
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10005548genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.84.9e-4152128177
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                  +Cqve+C a+lse k+yhrrhkvC++hsk+p+vlvsgl+qrfCqqCsrfhe+sefDe+krsCrrrLa+hnerrrk++
  Lus10005548  52 CCQVERCGANLSEGKQYHRRHKVCDFHSKCPSVLVSGLRQRFCQQCSRFHEVSEFDEAKRSCRRRLAGHNERRRKSS 128
                  6**************************************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.5E-3148114IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.70150127IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.66E-3751130IPR004333Transcription factor, SBP-box
PfamPF031108.8E-3153126IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MDFRTTLLPN DHQVDDDEVE DQQLQEFDHE VIGSWKKGAG GLPPPRRASN LCCQVERCGA  60
NLSEGKQYHR RHKVCDFHSK CPSVLVSGLR QRFCQQCSRF HEVSEFDEAK RSCRRRLAGH  120
NERRRKSSST TAAESSNYGG GISAQMQQHQ CTNNSRQSDI NNTDGGIRFQ QVAAAGNLNY  180
KRSQIRY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-35531261184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10005548
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018850782.12e-48PREDICTED: squamosa promoter-binding-like protein 3
SwissprotQ387411e-39SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLA0A4D6J0J83e-48A0A4D6J0J8_MANIN; SPL5
STRINGLus100055481e-138(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53534153
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.17e-41squamosa promoter binding protein-like 5
Publications ? help Back to Top
  1. Klein J,Saedler H,Huijser P
    A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA.
    Mol. Gen. Genet., 1996. 250(1): p. 7-16
    [PMID:8569690]