PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10005282
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family WOX
Protein Properties Length: 396aa    MW: 43699.5 Da    PI: 7.3102
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10005282genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox535.9e-1757117257
                  T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                  ++R+++++eq+++Le+ F++   +p ++e++++  +l    ++ +++V++WFqNr+ + k+
  Lus10005282  57 KPRWNPKPEQIRILEAIFNSgIVNPPRDEIRKIRVQLqefgQVGDANVFYWFQNRKSRSKH 117
                  89*****************99*************************************995 PP

2Wus_type_Homeobox108.53.8e-3556118264
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        +++RW+P+peQi+iLe++++sG+++P+++ei++i+ +L+e+G+++d+NVfyWFQNrk+R+++k
        Lus10005282  56 PKPRWNPKPEQIRILEAIFNSGIVNPPRDEIRKIRVQLQEFGQVGDANVFYWFQNRKSRSKHK 118
                        689**********************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-641116IPR009057Homeodomain-like
SuperFamilySSF466891.03E-1151121IPR009057Homeodomain-like
PROSITE profilePS5007110.20353118IPR001356Homeobox domain
SMARTSM003891.1E-655122IPR001356Homeobox domain
CDDcd000861.79E-756118No hitNo description
PfamPF000461.8E-1457117IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009735Biological Processresponse to cytokinin
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0010075Biological Processregulation of meristem growth
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MASSNRHWPS LFKSKPAPCN PHHHHPWQHD VTPPPPTHRP NSSYNPVGGE ERSPEPKPRW  60
NPKPEQIRIL EAIFNSGIVN PPRDEIRKIR VQLQEFGQVG DANVFYWFQN RKSRSKHKLR  120
HLQPSKTTSY QPPNPPTTTI SAVSSSSSSS SDNFKPSPRS AGSKRTLSSR SEQNGVVLLD  180
PSTTTTHQPS SCDFFSSEPA PFFMSGQHPT GFSFSEPVVG NVVGPCTSLL LSDILNLNHY  240
RKLMDQVDED HDGIKKLQLD HHHHQICYSN ETNTNGNVVT TTSPIVGLAC NPVTAPSSFL  300
SHIPVGMGST PGDHHQESEQ TNSSKTTVFI NDVAFEVGTG PFNVREAFGD DMLLVHSSGQ  360
PVLTDDWGIT LQSLNHGVFY YLVPFPSTAH HVSHI*
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10005282
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022723741.11e-105WUSCHEL-related homeobox 9-like
TrEMBLW8Q0341e-104W8Q034_POPTO; WOX9b
STRINGLus100052820.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38243361
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.13e-55homeobox-3