PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10005274
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family VOZ
Protein Properties Length: 622aa    MW: 69036.4 Da    PI: 4.944
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10005274genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ4151.4e-1273485651217
          VOZ   1 pppsaflgpkcalwdctrpaqg.sewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelfd 97 
                  pppsaflgpkcalwdc+rpaqg  + +q  cs fh +lalneglpgt pvlrp+gi+lkdgllfaal +k++gkevgipecegaatakspwna+elf+
  Lus10005274 348 PPPSAFLGPKCALWDCARPAQGgLDFWQMCCSRFHHDLALNEGLPGTGPVLRPGGIGLKDGLLFAALGSKAEGKEVGIPECEGAATAKSPWNAPELFN 445
                  89******************9637999*********************************************************************** PP

          VOZ  98 lsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekks 195
                  ls+lege irewlffdkprrafesgnrkqrslpdysgrgwhesrkqvm+efgglkrsyymdpqp+++fewhlyeyei+++da+alyrlelk vd+kks
  Lus10005274 446 LSVLEGEMIREWLFFDKPRRAFESGNRKQRSLPDYSGRGWHESRKQVMNEFGGLKRSYYMDPQPLNNFEWHLYEYEITKCDACALYRLELKAVDGKKS 543
                  ************************************************************************************************** PP

          VOZ 196 akgkvskdsladlqkklgrlta 217
                  akgk+s+ds+a+lqk++grlta
  Lus10005274 544 AKGKLSNDSVAHLQKQMGRLTA 565
                  ********************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 622 aa     Download sequence    Send to blast
MGKGSKPNCK STSHRQFKDR AKNRVDDLQG IFVDLQFARK ESRNVDVAVL EEQVHQMLRE  60
WKSELNEPSP ASSLQQGASL GSFSTDICRL LQLCEEEDDA TSTLAVPKPE PNDQTLQDVD  120
SAMFPQTYGL THGQQEQCYP FVTQCKDTPS AARGVVVSSL EGTQLDCHHQ FDLPQNFEQN  180
FFIGFNGVHL FGEDGNQNVA TYLPVSWNFV CVGCLQGASL GSFSTDICRL LQLCEEEDDA  240
TSTLAVPKPE PNVQTLQDVD SAMFPQSYGF THGQQEQCYP FVTQCKDTPS AARGVVVSSL  300
EGTQLDCHHQ FDLPQNFEQN FFIGFNGVHL FGEDGNQNVA TYLPGICPPP SAFLGPKCAL  360
WDCARPAQGG LDFWQMCCSR FHHDLALNEG LPGTGPVLRP GGIGLKDGLL FAALGSKAEG  420
KEVGIPECEG AATAKSPWNA PELFNLSVLE GEMIREWLFF DKPRRAFESG NRKQRSLPDY  480
SGRGWHESRK QVMNEFGGLK RSYYMDPQPL NNFEWHLYEY EITKCDACAL YRLELKAVDG  540
KKSAKGKLSN DSVAHLQKQM GRLTAEFPTD NKRPAKGRPK MDTKLGNPYP AANRVVPTTE  600
AFEYGLGYNY LGDNIDDYFV T*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10005274
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012091686.10.0transcription factor VOZ1 isoform X1
RefseqXP_012091688.10.0transcription factor VOZ1 isoform X1
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A438IGQ00.0A0A438IGQ0_VITVI; Transcription factor VOZ1
STRINGLus100052740.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14983494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]