PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10005204
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NAC
Protein Properties Length: 399aa    MW: 44162.1 Da    PI: 9.1515
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10005204genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM154.83.8e-48251511128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                  + pGfrF+P+d el+++yLkkk++g++  + evi++v+i+k+ePwdLp k+v ++e+ew+fFs+r +ky++g++++rat+ gyWkatgk+++v s ++
  Lus10005204  25 MFPGFRFSPSDVELISYYLKKKLDGEEKCV-EVIPHVEICKHEPWDLPaKSVVQSETEWFFFSSRGRKYPNGSQSKRATELGYWKATGKERSVRS-GS 120
                  579************************777.99***************667777899*************************************9.9* PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  +++g+k+tLvf+ grapkge+t+W+mhe+ +
  Lus10005204 121 AVIGTKRTLVFHIGRAPKGERTEWIMHEFCM 151
                  *****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.07E-5218166IPR003441NAC domain
PROSITE profilePS5100550.92425167IPR003441NAC domain
PfamPF023653.2E-2327150IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009626Biological Processplant-type hypersensitive response
GO:0009910Biological Processnegative regulation of flower development
GO:0034976Biological Processresponse to endoplasmic reticulum stress
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MATVATKNGG GVSRETKKSI EASTMFPGFR FSPSDVELIS YYLKKKLDGE EKCVEVIPHV  60
EICKHEPWDL PAKSVVQSET EWFFFSSRGR KYPNGSQSKR ATELGYWKAT GKERSVRSGS  120
AVIGTKRTLV FHIGRAPKGE RTEWIMHEFC MHSGSNDSLV VCRLRRNVDF RGHHPTNDAS  180
EGNRVVEVNA AAESSKKTNS STSNSYSIEQ IDSASNDFVC YQQPNVVTPP AVAETSNHFQ  240
LLNGFTQPDE DFFAEILNDD IIKLDETLLP TSLPHASADR VQGLQPSWMA AAPSNRRVKL  300
ESRRRKKKID QVAAAVEGED EEAEKERRSK SKKVPSCAVG LVMFVRKKGG NGMALLFVVV  360
VLAVVGLLGL VGSLYGEVRG TESVRRVLHL PDSWFRLA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-38111642165Stress-induced transcription factor NAC1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1326332RRSKSKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10005204
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012078968.11e-115NAC domain-containing protein 89
TrEMBLR4NEV61e-114R4NEV6_JATCU; NAC transcription factor 050
STRINGLus100052040.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73153346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22290.14e-93NAC domain containing protein 89