PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10005134
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB_related
Protein Properties Length: 740aa    MW: 80579.6 Da    PI: 6.4149
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10005134genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.54.7e-162468147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
      Lus10005134 24 RERWTDEEHNRFLEALKLYGRA-WQKIEEHIG-TKTAVQIRSHAQKF 68
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.74E-171874IPR009057Homeodomain-like
PROSITE profilePS5129421.0031973IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-82175IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-162271IPR006447Myb domain, plants
SMARTSM007177.3E-132371IPR001005SANT/Myb domain
PfamPF002494.4E-132467IPR001005SANT/Myb domain
CDDcd001671.74E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 740 aa     Download sequence    Send to blast
MDALSSGEDL LIKTRKPYTI TKQRERWTDE EHNRFLEALK LYGRAWQKIE EHIGTKTAVQ  60
IRSHAQKFFS KLEKEAVTKG VPVAQALDID IPPPRPKRKP SNPYPRKTGA SLVTSQAGAK  120
EDGKLSTSLP FPPSKVLDLE KEPLPEKPSG DEKSTGAKEN HDESCSEVFT SSSSIFSLKK  180
NSTLQPGGPR NPCSFREFVP CPKDAASQDE SRVTTELDGN KKWHKPELTP KFYDNGSSKA  240
PQLGHSCHSL EKLHQHKNNA DGDAIMVPED KIQAMQNCPR HVPVHILDGN VPSNESTVPV  300
EESHARSDVY SLPTASAAEF PNNMAACSTN QSFPPFPHPF APSLHNQDDY RSFVQMSSAF  360
SSLIASTLLQ NPAAHAAASF AASFWPYANV GNPADSSTFT SGGFSSRPVH ASAPSMAAIA  420
AATVAAATAW WAAHGMLPMC APQHTAFTCP PAPGIPAAHK DMLGTEKIET KEGKLEHPPL  480
DDVRMDHVKN SETGQAQNSS SKSPTMSESP KVAYQEMNPT TAPVAHDCSE PKNKKQVDRS  540
SCGSNTASSS EVETDALEKN NGNEGNDETK EADAENLLPA AITEPGTRRI LRSNGGMNDS  600
WKSVSQVGRL AFQALFTREK LPQSFSPPQN GAHRGVEMMQ NEDERTNGEA TTIIDLNNDA  660
WCHDQQEEEN NAASCNHEEE CLPKIGIENG KLLKARRTGF KPYKRCSMEA KENTLTTSSQ  720
GDEKESKRIR LALEGEASI*
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10005134
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021611101.10.0protein LHY-like isoform X2
TrEMBLA0A251LUQ00.0A0A251LUQ0_MANES; Uncharacterized protein
STRINGLus100051340.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48602537
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.41e-107MYB_related family protein