PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10004806
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family Trihelix
Protein Properties Length: 327aa    MW: 37855.4 Da    PI: 7.4508
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10004806genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix781.5e-2448130186
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                  +W+ qe+++ + +r e+++++ ++k++k lWe +s+km+e+gf rsp+qCk+kw+nl +ryk ++++e +     ++++p++++l+
  Lus10004806  48 QWSIQETKEFLMIRAELDRTFMETKRNKLLWEVISSKMKEKGFLRSPEQCKCKWKNLVTRYKGCETMEPES---MRQQFPFYSELQ 130
                  7********************************************************************84...45589****997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122033.67E-2447112No hitNo description
PfamPF138373.8E-2048132No hitNo description
PROSITE profilePS500907.09749105IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MEGHGRHHHQ QHPHHLQQQL LHPYQQQQHH PQPHQQIVGE TGDSRFPQWS IQETKEFLMI  60
RAELDRTFME TKRNKLLWEV ISSKMKEKGF LRSPEQCKCK WKNLVTRYKG CETMEPESMR  120
QQFPFYSELQ AIFAGRMQRM LWAEAQAGSG SGAPTSSSGS RKRGQHHLMS SDEEDELDDD  180
IELEPAASEG DKPPAAAVQT TAATTRNNKK TKKGKGNVVG DNSSSNAAVA AMKEVLEEFT  240
RQQMAAEMTW REAYEVRENE RRMQEMEWRR KMEALENERV MMERRWRERE EQRRVREEAR  300
AEKRDALITA LLNKLARDEG GGDGGT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A2e-1349128786DNA binding protein GT-1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00481DAPTransfer from AT5G01380Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012831841.11e-101PREDICTED: trihelix transcription factor GT-3b
SwissprotQ9SDW03e-77TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLA0A022RPD31e-101A0A022RPD3_ERYGU; Uncharacterized protein
STRINGPOPTR_0006s10240.11e-97(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.18e-63Trihelix family protein