PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10004772
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family GeBP
Protein Properties Length: 382aa    MW: 42037.5 Da    PI: 4.7914
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10004772genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57391.31.1e-28161255298
       DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWgs 98 
                  lf+r+w e+De++lL Gl++f +k+g++p+++i ++y+ vkks+++++s sql eK  rLKkKf k+ +  k+g+ +sf+k+hdqk+ +lskkiWgs
  Lus10004772 161 LFHRIWGEDDEVALLNGLLEF-SKRGVDPFKEIADVYDVVKKSLNIDISVSQLKEKAFRLKKKFMKNANG-KDGEGKSFTKQHDQKCSDLSKKIWGS 255
                  799******************.99*****************************************99998.9***********************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.5E-25162254IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MAPKRNLPKE DPPAPSTVEE EEEEEEEEEE EDSSTESEEE EDSSPEEKPS APRSQAQLKN  60
PAIQEQDDDS ESEENSDDPD TDSDSDPPPP AKTVANVKPI ASKPMESKSS TKAPASSAAA  120
SKARKRATHT ETEGKDTKRR KEESSSAVVA AKSEDSAKKQ LFHRIWGEDD EVALLNGLLE  180
FSKRGVDPFK EIADVYDVVK KSLNIDISVS QLKEKAFRLK KKFMKNANGK DGEGKSFTKQ  240
HDQKCSDLSK KIWGSEASSR AVEAINNAPP KPNKKEKGNS SNGITPKRHS GIENGGAVQK  300
KETKGNGKTE ESSSCKLVML PGEDIRDIVI KKGLDMMEGS KRGEFEERWK DVHVATLKLF  360
VQREQLVVDQ AKLMLAAMDE D*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1123140RKRATHTETEGKDTKRRK
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10004772
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8878195e-42HQ887819.1 Linum usitatissimum clone GMU2AYZ01AZVCG microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGLus100047720.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25210.19e-18DNA-binding storekeeper protein-related transcriptional regulator