PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10004638
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MIKC_MADS
Protein Properties Length: 232aa    MW: 26201.9 Da    PI: 9.267
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10004638genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.42.9e-31959151
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+gklye++s
  Lus10004638  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALILFSSRGKLYEFCS 59
                 79***********************************************96 PP

2K-box836.6e-28811738100
        K-box   8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                  s++++++++ +q++ kLk+++e L+r+qRhllGe+L++L  keL q+e+qL+ slk+iR  K++++++q+++l++k + l+e+nkaL  klee
  Lus10004638  81 SQTSRETQNNYQDYLKLKEKVEDLKRSQRHLLGEELGNLGAKELDQMENQLDGSLKQIRLVKTQVIVDQLSNLKQKGDLLEETNKALLIKLEE 173
                  3678899********************************************************************************999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.291161IPR002100Transcription factor, MADS-box
SMARTSM004321.0E-40160IPR002100Transcription factor, MADS-box
CDDcd002652.19E-43278No hitNo description
SuperFamilySSF554557.46E-34288IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-32323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003194.3E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-323859IPR002100Transcription factor, MADS-box
PfamPF014866.0E-2383171IPR002487Transcription factor, K-box
PROSITE profilePS5129714.6687177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALILFSS RGKLYEFCSS  60
SSMVKTIEKY QRYTYGQLEP SQTSRETQNN YQDYLKLKEK VEDLKRSQRH LLGEELGNLG  120
AKELDQMENQ LDGSLKQIRL VKTQVIVDQL SNLKQKGDLL EETNKALLIK LEETNAGMRH  180
STWEVGENSA DQQPHQQIIA TEKPSSSSAV AETVMINGGS GALISRPPWM L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A3e-24751711101Developmental protein SEPALLATA 3
4ox0_B3e-24751711101Developmental protein SEPALLATA 3
4ox0_C3e-24751711101Developmental protein SEPALLATA 3
4ox0_D3e-24751711101Developmental protein SEPALLATA 3
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMADS-box transcription factor that acts redundantly with J2 to control meristem maturation and inflorescence architecture. {ECO:0000269|PubMed:28528644}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10004638
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB6231632e-55AB623163.2 Pyrus pyrifolia var. culta PpMADS9-1 mRNA for MADS-box protein, complete cds.
GenBankAJ0016812e-55AJ001681.1 Malus domestica mRNA for MADS box protein MdMADS8.
GenBankKC4152372e-55KC415237.1 Malus domestica cultivar Fuji Beni Shogun MADS8-2 mRNA, complete cds.
GenBankKC4152382e-55KC415238.1 Malus domestica cultivar Fuji Beni Shogun MADS8-1 mRNA, complete cds.
GenBankKP1640022e-55KP164002.1 Pyrus pyrifolia clone PpSEP1-1 SEP1-like MADS-box protein mRNA, complete cds.
GenBankKP1640162e-55KP164016.1 Pyrus pyrifolia clone PpSEP1-2 SEP1-like MADS-box protein mRNA, complete cds.
GenBankU789472e-55U78947.1 Malus domestica MADS-box protein 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021903284.16e-92MADS-box protein CMB1
SwissprotQ7Y0406e-86EJ2_SOLLC; MADS-box protein EJ2
TrEMBLA0A2K1ZEQ12e-89A0A2K1ZEQ1_POPTR; Uncharacterized protein
STRINGLus100046381e-169(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22932178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02310.12e-83MIKC_MADS family protein
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  2. Soyk S, et al.
    Bypassing Negative Epistasis on Yield in Tomato Imposed by a Domestication Gene.
    Cell, 2017. 169(6): p. 1142-1155.e12
    [PMID:28528644]