PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10004161
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family HD-ZIP
Protein Properties Length: 358aa    MW: 38932.4 Da    PI: 8.8282
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10004161genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.81.8e-18191245256
                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  rk+ +++k+q   Lee F+++++++ ++++ LAk+l+L  rqV vWFqNrRa+ k
  Lus10004161 191 RKKLRLSKDQSAFLEESFKEHSTLNPKQKQALAKQLNLRPRQVEVWFQNRRARTK 245
                  678899***********************************************98 PP

2HD-ZIP_I/II126.61.1e-40191280191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rlsk+q+++LEesF+e+++L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +l
  Lus10004161 191 RKKLRLSKDQSAFLEESFKEHSTLNPKQKQALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELR-AL 280
                  69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.5E-18174248IPR009057Homeodomain-like
SuperFamilySSF466893.29E-18182248IPR009057Homeodomain-like
PROSITE profilePS5007117.329187247IPR001356Homeobox domain
SMARTSM003892.8E-16189251IPR001356Homeobox domain
CDDcd000861.86E-16191248No hitNo description
PfamPF000467.1E-16191245IPR001356Homeobox domain
PROSITE patternPS000270222245IPR017970Homeobox, conserved site
SMARTSM003403.3E-24247291IPR003106Leucine zipper, homeobox-associated
PfamPF021837.3E-11247281IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MELALSLGDN SKPFKFLDKS TPRTSPVDHH LGFCIGGGSG APAPPPTTTS PAAARSQEII  60
NSSINDRRDI AVGSSRVSSA GRPFQLDLLP FSPVTGKRPS PPETRFPWLV TEPALVTSSE  120
HGVGDGSRRF DVNRLSAEEG EDVDGASLSS PNSAASSFQM EFGIGLGSKR DLEGELAGSR  180
ASDDDENGST RKKLRLSKDQ SAFLEESFKE HSTLNPKQKQ ALAKQLNLRP RQVEVWFQNR  240
RARTKLKQTE VDCEYLKRCC ETLTEENRRL QKELQELRAL KTNSQPFYMQ PPATTLTMCP  300
SCERVATTTG GNKPTTKPSS STALSLGNSN NGRTVNPFSD VQLQRSQQNQ PNQPAAS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1189195TRKKLRL
2239247RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10004161
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX1744451e-132JX174445.1 Linum usitatissimum clone LuBAC364K11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024459020.11e-129homeobox-leucine zipper protein HAT14
SwissprotP466656e-85HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLI6YHV31e-161I6YHV3_LINUS; Putative homeobox-leucine zipper protein
STRINGLus100041610.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-80homeobox from Arabidopsis thaliana