PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10003848
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NAC
Protein Properties Length: 102aa    MW: 11662.2 Da    PI: 6.5177
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10003848genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM96.83.2e-301494184
          NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWk 84
                 lp+GfrFhPtd+elv++yL++k +++k  +  +i+e+d+yk++Pw+Lpk++  +ekewyfFs+rd+ky++g+r+nra  +g+W 
  Lus10003848 14 LPAGFRFHPTDDELVTHYLCRKYSDQKPAA-PIIAELDLYKFDPWELPKMAMYGEKEWYFFSPRDRKYPNGSRPNRA--AGFWL 94
                 799************************777.88***************7666789*********************8..79995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-33793IPR003441NAC domain
PROSITE profilePS5100530.84914101IPR003441NAC domain
PfamPF023652.3E-141593IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 102 aa     Download sequence    Send to blast
MNSPSTAVED QLSLPAGFRF HPTDDELVTH YLCRKYSDQK PAAPIIAELD LYKFDPWELP  60
KMAMYGEKEW YFFSPRDRKY PNGSRPNRAA GFWLSLLSSV G*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-42891992Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in disease resistance response (PubMed:16115070, PubMed:19625399). May function as repressor of pathogenesis-related proteins (PubMed:16115070). May function in the regulation of host basal defense responses against viral infection (PubMed:19625399). Transcriptional activator involved in responses to wounding and infection with tobamovirus (TMV) (PubMed:22937923). Binds to the DNA sequences 5'-AAAATATCT-3' and 5'AGATTTTT-3' of CYP734A1/BAS1 and CYP72C1/SOB7 promoters, respectively. Acts as suppressor of the brassinosteroid (BR)-inactivating enzymes CYP734A1/BAS1 and CYP72C1/SOB7, and prevents their expression in almost all tissues. Plays a central role in integrating BR homeostasis and seedling development. Regulates the spatial regulation of BR homeostasis and participates in the regulation of hypocotyl elongation and root growth by suppressing BR catabolism. Mediates connection between BR catabolism and photomorphogenesis (PubMed:26493403). Binds to, and transactivates the promoter of the auxin biosynthetic gene NIT2 (PubMed:22965747). Stress-responsive NAC transcription factor involved in ABA-inducible leaf senescence signaling (PubMed:26518251). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:16115070, ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:19625399, ECO:0000269|PubMed:22937923, ECO:0000269|PubMed:22965747, ECO:0000269|PubMed:26493403, ECO:0000269|PubMed:26518251}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10003848
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by wounding, salicylic acid (SA), methyl jasmonate, drought stress, dark and sucrose starvation (PubMed:16115070). Induced by chitin elicitor (chitooctaose) (PubMed:17722694). Induced by salicylic acid and infection with tobamovirus (TMV) (PubMed:19625399). By indole-3-acetonitrile, salicylic acid (SA), sodium nitroprusside (SNP), salt stress and drought stress (PubMed:22965747). Down-regulated by brassinosteroid (BR) and transition from dark to white light (PubMed:26493403). {ECO:0000269|PubMed:16115070, ECO:0000269|PubMed:17722694, ECO:0000269|PubMed:19625399, ECO:0000269|PubMed:22965747, ECO:0000269|PubMed:26493403}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0952098e-35FP095209.1 Phyllostachys edulis cDNA clone: bphylf057o13, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001313965.18e-46NAC domain-containing protein 2-like
RefseqXP_012482550.17e-46PREDICTED: NAC domain-containing protein 2-like
SwissprotQ9C5981e-43NAC81_ARATH; Protein ATAF2
TrEMBLA0A0D2N9J62e-44A0A0D2N9J6_GOSRA; Uncharacterized protein
TrEMBLA0A2P5SF472e-44A0A2P5SF47_GOSBA; Uncharacterized protein
TrEMBLC0J1R42e-44C0J1R4_GOSHI; NAC domain protein NAC3
STRINGLus100038482e-70(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF125834108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08790.15e-46NAC family protein
Publications ? help Back to Top
  1. Takasaki H, et al.
    SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence.
    Plant J., 2015. 84(6): p. 1114-23
    [PMID:26518251]