PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10003435
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NAC
Protein Properties Length: 357aa    MW: 38959.5 Da    PI: 6.2427
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10003435genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.41.9e-55161431129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrFhP+dee+v++yL++kv+++++++  ++ e+d++k+ePwdLp k+k +ekewyfF++rdkky+tg r+nrat +gyWkatgkdke+++ +g 
  Lus10003435  16 LPPGFRFHPSDEEIVTHYLTEKVKDSNFTA-IAVGEADLNKSEPWDLPCKAKMGEKEWYFFCQRDKKYPTGMRTNRATVAGYWKATGKDKEIFRGRGC 112
                  79*************************999.88***************999999******************************************** PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrle 129
                  lvg+kktLvfy+grapkgekt+Wvmhe+rle
  Lus10003435 113 LVGMKKTLVFYRGRAPKGEKTNWVMHEFRLE 143
                  ****************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.66E-6111168IPR003441NAC domain
PROSITE profilePS5100558.28816168IPR003441NAC domain
PfamPF023652.2E-2817142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MEEPAVSNTG DEVLDLPPGF RFHPSDEEIV THYLTEKVKD SNFTAIAVGE ADLNKSEPWD  60
LPCKAKMGEK EWYFFCQRDK KYPTGMRTNR ATVAGYWKAT GKDKEIFRGR GCLVGMKKTL  120
VFYRGRAPKG EKTNWVMHEF RLEGNFSYYS FPKASSKDEW VVCRVFHKSP AASAVSSSSG  180
GGVMMKRTSP VEELMRPASN SFGDDFFDCS LSLPPLMDLP YADSVLNDFA KQLPNSNNCN  240
NTFTNHHHLT SSNSPYIGGS GAGRGGVQLY TFPTTAGAGY LHRGGFGHEC KLEQQQSMVS  300
LSQDTGLSTD NMNAAPEITS KQLGIGISGG GGEDPSTSAG GSTSGMVELD SFWDNY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-521417315170NO APICAL MERISTEM PROTEIN
1ut4_B8e-521417315170NO APICAL MERISTEM PROTEIN
1ut7_A8e-521417315170NO APICAL MERISTEM PROTEIN
1ut7_B8e-521417315170NO APICAL MERISTEM PROTEIN
3swm_A1e-511417318173NAC domain-containing protein 19
3swm_B1e-511417318173NAC domain-containing protein 19
3swm_C1e-511417318173NAC domain-containing protein 19
3swm_D1e-511417318173NAC domain-containing protein 19
3swp_A1e-511417318173NAC domain-containing protein 19
3swp_B1e-511417318173NAC domain-containing protein 19
3swp_C1e-511417318173NAC domain-containing protein 19
3swp_D1e-511417318173NAC domain-containing protein 19
4dul_A8e-521417315170NAC domain-containing protein 19
4dul_B8e-521417315170NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10003435
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021620729.11e-123NAC domain-containing protein 100-like
SwissprotQ9FK441e-105NAC87_ARATH; NAC domain-containing protein 87
TrEMBLA0A0M4FBP61e-122A0A0M4FBP6_MANES; NAC transcription factors 15
STRINGLus100034350.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.21e-103Arabidopsis NAC domain containing protein 87
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]