PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10003367
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NAC
Protein Properties Length: 532aa    MW: 60318.2 Da    PI: 6.5972
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10003367genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.43.6e-50601852128
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                  +pGfrFhPt+eelv +yL++kvegk++++ e i+ +d+y+++Pw+Lp++++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ + +++++ 
  Lus10003367  60 MPGFRFHPTEEELVEFYLRRKVEGKRFNV-ELITFLDLYRFDPWELPAMAAIGEKEWFFYVPRDRKYRNGDRPNRVTTSGYWKATGADRMIRTENSRS 156
                  79***************************.89***************888889********************************************* PP

          NAM 100 vglkktLvfykgrapkgektdWvmheyrl 128
                  +glkktLvfy+g+apkg +t+W+m+eyrl
  Lus10003367 157 IGLKKTLVFYSGKAPKGIRTSWIMNEYRL 185
                  ***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100555.80459206IPR003441NAC domain
SuperFamilySSF1019416.41E-5659205IPR003441NAC domain
PfamPF023659.2E-2561185IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 532 aa     Download sequence    Send to blast
MSNEEANSSS PSSLPLPAGE GNNNNNNSGG SNRELLPAEG GNEVEEEEEE EDEHEHDMVM  60
PGFRFHPTEE ELVEFYLRRK VEGKRFNVEL ITFLDLYRFD PWELPAMAAI GEKEWFFYVP  120
RDRKYRNGDR PNRVTTSGYW KATGADRMIR TENSRSIGLK KTLVFYSGKA PKGIRTSWIM  180
NEYRLPHHDT QRYQKTEISL CRVYKRAGVE DHHGGPSSLP RSLPSSINRH QNHMGASSSS  240
SKKHQRSSHQ EQQHLLQPPS SHHPSDQHQH QLLQLQPFST QVMMLMDIDK LTNTTSTTTT  300
TAADTSCTAT TTSTSTSTDS NLGAAGLISN TTSLGLLPAT LGPDHSLLLP PHDQQQQQVG  360
HHHHRRQEDE EQLILLLNRG GGPSDHQPST SSNMNSSNTT LPAGLDDLQR LVNYNQHQQQ  420
YYTRLLQHQH QHHQQQNDDP SNYNHPQHHH QLLQQMMIFP PTTPSPQQIL LPTTSLPTIN  480
NRSASSSLNI WDWNLLPPPP SQHQHHQSDD QNHPHPPPHY DTNNDDINPF K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-554920610168NAC domain-containing protein 19
3swm_B3e-554920610168NAC domain-containing protein 19
3swm_C3e-554920610168NAC domain-containing protein 19
3swm_D3e-554920610168NAC domain-containing protein 19
3swp_A3e-554920610168NAC domain-containing protein 19
3swp_B3e-554920610168NAC domain-containing protein 19
3swp_C3e-554920610168NAC domain-containing protein 19
3swp_D3e-554920610168NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10003367
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8852016e-95HQ885201.1 Linum usitatissimum clone Contig1062 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012078844.11e-126NAC domain-containing protein 35-like
TrEMBLR4N5L61e-125R4N5L6_JATCU; NAC transcription factor 036
STRINGLus100033670.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72033146
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.21e-102NAC domain containing protein 35