PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10003333
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NAC
Protein Properties Length: 304aa    MW: 35145.7 Da    PI: 7.4154
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10003333genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM144.75.1e-45171452128
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk..k 96 
                   pGfrFhPt+eel+++yL++ v gkkl+l +vi  ++iy+++P+dLpk +k  +e+ewyf ++rd+k+  + r+nr+t++g+Wkatg+d+++ +    
  Lus10003333  17 LPGFRFHPTEEELIDFYLNNMVFGKKLSL-DVIGYLNIYRYDPRDLPKLAKInGEREWYFIVPRDRKHGGNGRPNRTTEKGFWKATGSDRKIWRLseP 113
                  69**************************9.99***************633332678************************************886557 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  ++++gl+ktLvfy+grapkg ktdWvm+eyrl
  Lus10003333 114 KRQIGLRKTLVFYQGRAPKGIKTDWVMNEYRL 145
                  889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.97E-5312164IPR003441NAC domain
PROSITE profilePS5100551.68116164IPR003441NAC domain
PfamPF023656.9E-2418145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MSDTIDQMTS EQHQFTLPGF RFHPTEEELI DFYLNNMVFG KKLSLDVIGY LNIYRYDPRD  60
LPKLAKINGE REWYFIVPRD RKHGGNGRPN RTTEKGFWKA TGSDRKIWRL SEPKRQIGLR  120
KTLVFYQGRA PKGIKTDWVM NEYRLPDSSS PLPKEVVLCK IYRKATSLRV LEQRAEMEGQ  180
HQQQHSQFSS PLDTSSPPLS MSSSFCGSST TGPRQHQQEE EDGPPHQMLL GPMEDRHVAS  240
FVKREEADDD HHPSYDAKGI INHCNLLELQ VPKISMDWNQ DQFWLASPWL HQNLTPLANL  300
LNL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-4271677168NO APICAL MERISTEM PROTEIN
1ut4_B4e-4271677168NO APICAL MERISTEM PROTEIN
1ut7_A4e-4271677168NO APICAL MERISTEM PROTEIN
1ut7_B4e-4271677168NO APICAL MERISTEM PROTEIN
3swm_A6e-42716710171NAC domain-containing protein 19
3swm_B6e-42716710171NAC domain-containing protein 19
3swm_C6e-42716710171NAC domain-containing protein 19
3swm_D6e-42716710171NAC domain-containing protein 19
3swp_A6e-42716710171NAC domain-containing protein 19
3swp_B6e-42716710171NAC domain-containing protein 19
3swp_C6e-42716710171NAC domain-containing protein 19
3swp_D6e-42716710171NAC domain-containing protein 19
4dul_A4e-4271677168NAC domain-containing protein 19
4dul_B4e-4271677168NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10003333
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018849198.11e-108PREDICTED: NAC domain-containing protein 35-like
SwissprotQ10S656e-80NAC22_ORYSJ; NAC domain-containing protein 22
TrEMBLA0A2I4GZ821e-107A0A2I4GZ82_JUGRE; NAC domain-containing protein 35-like
STRINGLus100033330.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62143251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.12e-95NAC domain containing protein 36
Publications ? help Back to Top
  1. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]