PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10003269
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NAC
Protein Properties Length: 377aa    MW: 42670.9 Da    PI: 9.7705
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10003269genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.91.7e-52141421128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk..k 96 
                  lppGfrFhPtdeel+ +yL+kk+++ ++++ ++i++vdiyk++PwdLp+k++ +ekewyfFs+rd+ky++g r+nra++sgyWkatg+dk + +   +
  Lus10003269  14 LPPGFRFHPTDEELILHYLQKKLSSIPFPV-SIIADVDIYKFDPWDLPAKATFGEKEWYFFSPRDRKYPNGARPNRAAASGYWKATGTDKLISAFgdN 110
                  79****************************.89***************988899*************************************9987668 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  ++++g+kk Lvfykg+ pkg kt+W+mheyrl
  Lus10003269 111 HNNIGIKKALVFYKGKPPKGIKTNWIMHEYRL 142
                  888***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-644174IPR003441NAC domain
PROSITE profilePS5100561.85314174IPR003441NAC domain
PfamPF023653.8E-2715142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MAMMMKRRSP GSSLPPGFRF HPTDEELILH YLQKKLSSIP FPVSIIADVD IYKFDPWDLP  60
AKATFGEKEW YFFSPRDRKY PNGARPNRAA ASGYWKATGT DKLISAFGDN HNNIGIKKAL  120
VFYKGKPPKG IKTNWIMHEY RLSDPSSNYS SKTIRSKGSS MRLDDWVLCR IYKKTHSNLS  180
HNRPQTSSST TTVSSSDQDY EDKDQNYHQK QLSSQQTLFS FPSSKSPMIN NQHQVTPLMP  240
QKSSSFSNLL DAILSDPQFT FSSAGFESFP TEPTAYGADN ISNDGNYLYH KLPQLQSNNS  300
STTMALPNVE MTMMHNRPKR ERSTGNEDLS SMVNPLKKAM ASSRSHDVDD HNNGFLNYQM  360
ALNQQLLLSH HLQFQG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-761317719171NAC domain-containing protein 19
3swm_B3e-761317719171NAC domain-containing protein 19
3swm_C3e-761317719171NAC domain-containing protein 19
3swm_D3e-761317719171NAC domain-containing protein 19
3swp_A3e-761317719171NAC domain-containing protein 19
3swp_B3e-761317719171NAC domain-containing protein 19
3swp_C3e-761317719171NAC domain-containing protein 19
3swp_D3e-761317719171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the promoter of ACO5, an ACC oxidase involved in ethylene biosynthesis. Mediates waterlogging-induced hyponastic leaf movement, and cell expansion in abaxial cells of the basal petiole region, by directly regulating the expression of ACO5 (PubMed:24363315). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:24363315}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10003269
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By root flooding (PubMed:24363315). Induced by senescence (PubMed:24659488). {ECO:0000269|PubMed:24363315, ECO:0000269|PubMed:24659488}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022718970.11e-122NAC transcription factor 47-like
SwissprotQ84TD61e-108NAC47_ARATH; NAC transcription factor 47
TrEMBLA0A061F2491e-115A0A061F249_THECC; NAC domain containing protein 47, putative isoform 2
STRINGLus100032690.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66212750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.11e-100NAC domain containing protein 47
Publications ? help Back to Top
  1. Hofmann NR
    A NAC transcription factor for flooding: SHYG helps plants keep their leaves in the air.
    Plant Cell, 2013. 25(12): p. 4771
    [PMID:24363314]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]