PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10003125
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MIKC_MADS
Protein Properties Length: 182aa    MW: 20941.3 Da    PI: 10.0192
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10003125genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF100.66.2e-32959151
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  Lus10003125  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59
                 79***********************************************96 PP

2K-box86.17.2e-2983161886
        K-box   8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkeke 86 
                  s+ ea + s+qqe+ kLk+++e Lqr+qR+llGedL++Ls keL++Le+qL+ slk+iRs++++++l+q+++lq+k   
  Lus10003125  83 SAREALEISSQQEYLKLKARYEALQRSQRNLLGEDLGPLSTKELESLERQLDMSLKQIRSTRTQYMLDQLNDLQHKVTH 161
                  4556666789*****************************************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.515161IPR002100Transcription factor, MADS-box
CDDcd002651.61E-43276No hitNo description
SuperFamilySSF554555.23E-34276IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-33323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.3E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-333859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129713.27489181IPR002487Transcription factor, K-box
PfamPF014862.6E-2392162IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCSS  60
SSMLKTLERY QKCNYGAPES NVSAREALEI SSQQEYLKLK ARYEALQRSQ RNLLGEDLGP  120
LSTKELESLE RQLDMSLKQI RSTRTQYMLD QLNDLQHKVT HLIPPLYIVR YQTGGLVIKL  180
L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A1e-4275158186Developmental protein SEPALLATA 3
4ox0_B1e-4275158186Developmental protein SEPALLATA 3
4ox0_C1e-4275158186Developmental protein SEPALLATA 3
4ox0_D1e-4275158186Developmental protein SEPALLATA 3
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10003125
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011020782.11e-107PREDICTED: agamous-like MADS-box protein AGL9 homolog
SwissprotQ8LLR01e-105MADS4_VITVI; Agamous-like MADS-box protein MADS4
TrEMBLA0A2K2B8D91e-105A0A2K2B8D9_POPTR; Uncharacterized protein
STRINGLus100031251e-129(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22932178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.31e-101MIKC_MADS family protein
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  2. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  3. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]