PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10002687
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NAC
Protein Properties Length: 431aa    MW: 48387.7 Da    PI: 6.6953
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10002687genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.22.2e-51111391128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                  +ppGfrFhPt+eel+++yLkkkv+ kk++l +vi++vd++k+ePwd+++k+k     +++wyfFs++dkky+tg+r+nrat+ g+Wkatg+dk ++  
  Lus10002687  11 VPPGFRFHPTEEELLHYYLKKKVSFKKIDL-DVIRDVDLNKLEPWDIQEKCKIgttPQNDWYFFSHKDKKYPTGTRTNRATTVGFWKATGRDKVIHG- 106
                  69****************************.9***************964444222455**********************************9999. PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                  +g+ +g++ktLvfykgrap+g+k+dW+mheyrl
  Lus10002687 107 SGRRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 139
                  9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-567174IPR003441NAC domain
PROSITE profilePS5100555.46211174IPR003441NAC domain
PfamPF023654.7E-2712139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 431 aa     Download sequence    Send to blast
MSISVNGQSQ VPPGFRFHPT EEELLHYYLK KKVSFKKIDL DVIRDVDLNK LEPWDIQEKC  60
KIGTTPQNDW YFFSHKDKKY PTGTRTNRAT TVGFWKATGR DKVIHGSGRR IGMRKTLVFY  120
KGRAPHGQKS DWIMHEYRLD DTGQKSSPFN VSSSNFLGES GQEEGWVVCR IFTKKNLQKS  180
VVGPTTSPIT NSTASSIVVS TAIDARFVAS TSTIHMFNSC DKCELDKIIQ YVGNNCKEEI  240
YSNPPQPLTN SGYHQYNSYK DGRCDFMELP NLESPNCSPS GYPKMVNKAT FPVENDTNRA  300
SHNVNPVRYP VESTGLTTSW AALDQLVASQ LNGQHEYPVP TAATNVAYYR ASDCYDDHQQ  360
NDGDDDEVDG PDLPLPPIGI MMNSNNNRPY DDHHQEYNVS NNNEIIDLWS FGARSTTSAT  420
SNGVPRYATC *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-4751769170Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator of genes involved in biosynthesis of secondary walls. Together with NST2 and NST3, required for the secondary cell wall thickening of sclerenchymatous fibers, secondary xylem (tracheary elements), and of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues. {ECO:0000269|PubMed:16214898, ECO:0000269|PubMed:17237351, ECO:0000269|PubMed:17333250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00321DAPTransfer from AT2G46770Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10002687
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021691324.11e-137NAC domain-containing protein 43
SwissprotQ84WP61e-121NAC43_ARATH; NAC domain-containing protein 43
TrEMBLR4N7K11e-133R4N7K1_JATCU; NAC transcription factor 012
STRINGLus100026870.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30313374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-124NAC family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Gondolf VM, et al.
    A gene stacking approach leads to engineered plants with highly increased galactan levels in Arabidopsis.
    BMC Plant Biol., 2014. 14: p. 344
    [PMID:25492673]
  3. Jaradat MR,Ruegger M,Bowling A,Butler H,Cutler AJ
    A comprehensive transcriptome analysis of silique development and dehiscence in Arabidopsis and Brassica integrating genotypic, interspecies and developmental comparisons.
    GM Crops Food, 2014. 5(4): p. 302-20
    [PMID:25523176]
  4. Yuan Y,Teng Q,Zhong R,Ye ZH
    TBL3 and TBL31, Two Arabidopsis DUF231 Domain Proteins, are Required for 3-O-Monoacetylation of Xylan.
    Plant Cell Physiol., 2016. 57(1): p. 35-45
    [PMID:26556650]
  5. Yang C, et al.
    Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation.
    Plant Physiol., 2017. 175(1): p. 333-350
    [PMID:28724622]
  6. Pascual MB, et al.
    PpNAC1, a main regulator of phenylalanine biosynthesis and utilization in maritime pine.
    Plant Biotechnol. J., 2018. 16(5): p. 1094-1104
    [PMID:29055073]
  7. Liu C,Yu H,Li L
    SUMO modification of LBD30 by SIZ1 regulates secondary cell wall formation in Arabidopsis thaliana.
    PLoS Genet., 2019. 15(1): p. e1007928
    [PMID:30657769]