PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10002481
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family Trihelix
Protein Properties Length: 60aa    MW: 7217.61 Da    PI: 10.8935
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10002481genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix59.67.9e-192521363
     trihelix 13 arremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykk 63
                 +r e+++++ ++k++k lWe +++km+e+gf rsp+qCk+kw+nl +ryk+
  Lus10002481  2 IRAELDRTFMETKRNKLLWEVIASKMKEKGFLRSPEQCKCKWKNLVTRYKR 52
                 7999**********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122034.96E-18152No hitNo description
PfamPF138373.8E-14552No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 60 aa     Download sequence    Send to blast
MIRAELDRTF METKRNKLLW EVIASKMKEK GFLRSPEQCK CKWKNLVTRY KRDLRTVNV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010104264.16e-27Trihelix transcription factor GT-3b
SwissprotO804503e-24TGT3B_ARATH; Trihelix transcription factor GT-3b
TrEMBLW9RYU57e-27W9RYU5_9R
STRINGPGSC0003DMT4000777511e-25(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.12e-25Trihelix family protein