PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10001934
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family TALE
Protein Properties Length: 390aa    MW: 44059 Da    PI: 6.7135
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10001934genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.21.2e-073293612254
                  SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                   +yp++e++++L +++gL+ +q+ +WF N+R +
  Lus10001934 329 WPYPTEEDKARLVEETGLQLKQINNWFINQRKR 361
                  69*****************************87 PP

2ELK28.33.9e-10282303122
          ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                  ELKh+L+++Y+ ++ ++++E++
  Lus10001934 282 ELKHELKQGYKDKIADIREEIL 303
                  9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.0E-18115159IPR005540KNOX1
PfamPF037903.3E-17117158IPR005540KNOX1
SMARTSM012561.8E-26169225IPR005541KNOX2
PfamPF037912.3E-18178224IPR005541KNOX2
SMARTSM011880.001282303IPR005539ELK domain
PROSITE profilePS5121310.109282302IPR005539ELK domain
PROSITE profilePS5007111.677302365IPR001356Homeobox domain
SuperFamilySSF466893.64E-16304369IPR009057Homeodomain-like
SMARTSM003898.8E-11304369IPR001356Homeobox domain
CDDcd000861.79E-11305366No hitNo description
Gene3DG3DSA:1.10.10.601.4E-24309366IPR009057Homeodomain-like
PfamPF059201.1E-17322361IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MEFNHHNEEV PLHNFPAADQ TQQQQQQQQQ QQQVQVPTAS SQSPPNNWLN SALLLRGPQH  60
PPAADTNFLN LAASYDIIHN TTTPPDHSIS NQNHSLKQTS STPRESESGG GDSSGRYKGE  120
ILAHPLYEQL LSAHVACLRI ATPVDQLPRI DAQLAQSHNV VSKYPPPHHH LPTSPNHKEL  180
DQFMSHYFLL LCSFKEQLQE HVRVHAMEAV MACWEIEQSL QSLTGVSPGE GTGATMSDED  240
DDHVVVVESE LAVANSFDDS MGFGPLVPSE TERSLMERVR VELKHELKQG YKDKIADIRE  300
EILRKRRAGK LPGDTTSVLK SWWQSHSKWP YPTEEDKARL VEETGLQLKQ INNWFINQRK  360
RNWHTNPSST STSTSSKTKR KRYLRSFVN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A3e-12305369872Homeobox protein PKNOX1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10001934
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011458839.11e-158PREDICTED: homeobox protein knotted-1-like 3 isoform X2
SwissprotP480001e-150KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLA0A2J6JLQ91e-156A0A2J6JLQ9_LACSA; Uncharacterized protein
STRINGLus100019340.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF63483450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11060.11e-143KNOTTED1-like homeobox gene 4
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]