PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10001664
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NAC
Protein Properties Length: 412aa    MW: 45702.8 Da    PI: 6.2626
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10001664genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.21.1e-51161441128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                  +ppGfrFhPt+eel+++yL+kkv+++k++l +vi+evd++k+ePwd+++++k     +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk ++s 
  Lus10001664  16 VPPGFRFHPTEEELLHYYLRKKVASDKIDL-DVIREVDLNKLEPWDIQERCKIgstPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKIIYS- 111
                  69****************************.9***************964444222455**************************************. PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                  + + +gl+ktLvfykgrap+g+k+dW+mheyrl
  Lus10001664 112 GARRIGLRKTLVFYKGRAPHGQKSDWIMHEYRL 144
                  999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.84E-5612188IPR003441NAC domain
PROSITE profilePS5100555.44416188IPR003441NAC domain
PfamPF023652.6E-2717144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MRSEHVNLSV NGQSKVPPGF RFHPTEEELL HYYLRKKVAS DKIDLDVIRE VDLNKLEPWD  60
IQERCKIGST PQNDWYFFSH KDKKYPTGTR TNRATAAGFW KATGRDKIIY SGARRIGLRK  120
TLVFYKGRAP HGQKSDWIMH EYRLDDAAPA PFDTINSNPG MMVMMSNVVI GDQLGSEEGW  180
VVCRVFKKKN YQKTLDSPKL SSHVADSKPH ILMSSLSTAA ARYGTESSTT DGVLDQILMY  240
MGGRNGLTST SNCSIGATGT STGYCKAESD YLFHLPRLVA DHEQLQLSQS FGGGGDAMVT  300
SDDNNNNDNC NRFDVTAGSK GGMMVVNDWA ALDRLVASQL NGHLHHGHQD DVVEDDDDDV  360
DDQFRSMPNH HYEQQLMYGG GGESDNDVWT NFTKSSSSPS SSSDPLCHLS V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-4711903170Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator of genes involved in biosynthesis of secondary walls. Together with NST1, required for the secondary cell wall thickening and lignification of sclerenchymatous fibers and secondary xylem vessels (tracheary elements). Seems to repress the secondary cell wall thickening of xylary fibers. May also regulate the secondary cell wall lignification of other tissues. Binds to and activates the promoter of MYB46. {ECO:0000269|PubMed:17114348, ECO:0000269|PubMed:17237351, ECO:0000269|PubMed:17333250, ECO:0000269|PubMed:17565617, ECO:0000269|PubMed:17890373}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00016PBMTransfer from AT1G32770Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10001664
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ6934293e-74JQ693429.1 Brachypodium distachyon SWN8 (SWN8) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002518924.11e-136NAC domain-containing protein 43
SwissprotQ9LPI71e-115NAC12_ARATH; NAC domain-containing protein 12
TrEMBLB9RYV51e-135B9RYV5_RICCO; NAC domain-containing protein, putative
STRINGLus100016640.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30313374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32770.11e-106NAC domain containing protein 12
Publications ? help Back to Top
  1. Zhao Q, et al.
    Pinoresinol reductase 1 impacts lignin distribution during secondary cell wall biosynthesis in Arabidopsis.
    Phytochemistry, 2015. 112: p. 170-8
    [PMID:25107662]
  2. Fernández-Pérez F,Vivar T,Pomar F,Pedreño MA,Novo-Uzal E
    Peroxidase 4 is involved in syringyl lignin formation in Arabidopsis thaliana.
    J. Plant Physiol., 2015. 175: p. 86-94
    [PMID:25506770]
  3. Sakamoto S,Mitsuda N
    Reconstitution of a secondary cell wall in a secondary cell wall-deficient Arabidopsis mutant.
    Plant Cell Physiol., 2015. 56(2): p. 299-310
    [PMID:25535195]
  4. Yuan Y,Teng Q,Zhong R,Ye ZH
    TBL3 and TBL31, Two Arabidopsis DUF231 Domain Proteins, are Required for 3-O-Monoacetylation of Xylan.
    Plant Cell Physiol., 2016. 57(1): p. 35-45
    [PMID:26556650]
  5. Huang J,Chen F,Wu S,Li J,Xu W
    Cotton GhMYB7 is predominantly expressed in developing fibers and regulates secondary cell wall biosynthesis in transgenic Arabidopsis.
    Sci China Life Sci, 2016. 59(2): p. 194-205
    [PMID:26803299]
  6. Pascual MB, et al.
    PpNAC1, a main regulator of phenylalanine biosynthesis and utilization in maritime pine.
    Plant Biotechnol. J., 2018. 16(5): p. 1094-1104
    [PMID:29055073]