PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10001277
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MIKC_MADS
Protein Properties Length: 180aa    MW: 20029.3 Da    PI: 9.468
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10001277genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF79.13.2e-25957149
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                 krien   rqvtf+kRr+g+lKKA+ELSvLCdae+ v++fss+gk ye 
  Lus10001277  9 KRIENPVHRQVTFCKRRAGLLKKAKELSVLCDAEIGVLVFSSHGKHYEL 57
                 79*******************************************9996 PP

2K-box553.5e-1995170883
        K-box   8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkk 83 
                  + ++ ++++ ++e++ Lk+ei++Lq+ +R + G + ++++l+eL  Le++Le  + +iRs+K+e+++++i++l++k
  Lus10001277  95 ESKDPNQQNAKEEINMLKQEIQMLQKGLRYMFGGGDSEMTLEELLVLEKHLEIWVCQIRSTKMEIMFKEIQQLRNK 170
                  468899********************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.57E-28175IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.436161IPR002100Transcription factor, MADS-box
SMARTSM004322.8E-35160IPR002100Transcription factor, MADS-box
CDDcd002653.64E-38273No hitNo description
PRINTSPR004041.9E-26323IPR002100Transcription factor, MADS-box
PfamPF003194.5E-231056IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-263859IPR002100Transcription factor, MADS-box
PfamPF014863.2E-1897170IPR002487Transcription factor, K-box
PROSITE profilePS5129710.849101179IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MARGKVQMKR IENPVHRQVT FCKRRAGLLK KAKELSVLCD AEIGVLVFSS HGKHYELATK  60
GTMQGLIDKY MKCSPGSGSG SSSGSDSGAA QPVVESKDPN QQNAKEEINM LKQEIQMLQK  120
GLRYMFGGGD SEMTLEELLV LEKHLEIWVC QIRSTKMEIM FKEIQQLRNK VCLSSYKAS*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription activator that regulates root development by controlling cell proliferation in root meristem. May mediate responses to auxin in the root. May act as promoter of the flowering transition through up-regulation of SOC, FT and LFY. {ECO:0000269|PubMed:18203871}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10001277
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin in root phloem. {ECO:0000269|PubMed:18203871}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024439180.19e-83agamous-like MADS-box protein AGL12 isoform X2
SwissprotQ388416e-72AGL12_ARATH; Agamous-like MADS-box protein AGL12
TrEMBLA0A218W4Q43e-83A0A218W4Q4_PUNGR; Uncharacterized protein
STRINGLus100012771e-130(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF75663144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.13e-69AGAMOUS-like 12
Publications ? help Back to Top
  1. Zimmermann P,Hirsch-Hoffmann M,Hennig L,Gruissem W
    GENEVESTIGATOR. Arabidopsis microarray database and analysis toolbox.
    Plant Physiol., 2004. 136(1): p. 2621-32
    [PMID:15375207]
  2. Pacheco-Escobedo MA, et al.
    Longitudinal zonation pattern in Arabidopsis root tip defined by a multiple structural change algorithm.
    Ann. Bot., 2018.
    [PMID:27358290]
  3. GarcĂ­a-Cruz KV, et al.
    The MADS-box XAANTAL1 increases proliferation at the Arabidopsis root stem-cell niche and participates in transition to differentiation by regulating cell-cycle components.
    Ann. Bot., 2018.
    [PMID:27474508]