PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10000643
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family SBP
Protein Properties Length: 610aa    MW: 68269.7 Da    PI: 6.6117
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10000643genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1331e-41308383277
                  -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
          SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                  Cqv gC++dls +k+yh+rh+vCevh+k+p+v+v+g++qrfCqqCsrfh lsefD++krsCr+rLa+hnerrrk++
  Lus10000643 308 CQVYGCNKDLSLLKDYHKRHRVCEVHTKTPNVVVNGIQQRFCQQCSRFHLLSEFDDGKRSCRKRLAGHNERRRKPH 383
                  *************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF537563.05E-292133No hitNo description
PfamPF002012.9E-74498IPR002213UDP-glucuronosyl/UDP-glucosyltransferase
PROSITE profilePS5114132.753305382IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.102.6E-33305369IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.88E-39306385IPR004333Transcription factor, SBP-box
PfamPF031102.8E-32308381IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0016758Molecular Functiontransferase activity, transferring hexosyl groups
Sequence ? help Back to Top
Protein Sequence    Length: 610 aa     Download sequence    Send to blast
MEILLGFELC GRPFIVATTK LPRGCSSLPA GYAARVEGMG VVHYGWVPQV EILEHEWVGC  60
FVSHCGSSSM WEALASECKI VLMPNIVLQS ATAMFMAEEL KVAVEVEDSG GWIDKEELSR  120
TIGTAMDEES EVGNLLLRNH SYTDDFVSKL CALVGTGIFF AKCSSAFCLV VGSMTEPWSY  180
APERKASFFT SHEVDFPADI DSLEFVDLGF HDDVLRSPCF AGGGSSDEVG GFDSHNFAAA  240
SNSPLDSGSI EHSSSLVESN ILDSSFIIDL NLGRFAENGG EFCQKRSLLD FAEPGFQAKR  300
ARIVTPLCQV YGCNKDLSLL KDYHKRHRVC EVHTKTPNVV VNGIQQRFCQ QCSRFHLLSE  360
FDDGKRSCRK RLAGHNERRR KPHFGGLSSN GYKLLQQYQA EGASFLAPLP KRSSFLFQDM  420
LTVPHRNLRT ETNWYSHSLF KERSCCNTET AYPYNDQWLS TSPVSYHHGN GSNHHSSRAL  480
SLLSDESQHY FSSHGSLRGY PMAKPFPSLG SFGKYEFCSC RTNPIHVNHH LEHDAAEFHR  540
KRNGLFPPHN IPDPDSKRNN RGSPENERTV DLLQLSSHLQ RVEQQRSLVQ MKNETEDLFH  600
FLTTEGLRV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-283073811084squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10000643
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021667340.11e-93squamosa promoter-binding-like protein 6
RefseqXP_021667341.11e-93squamosa promoter-binding-like protein 6
TrEMBLA0A2C9WH274e-91A0A2C9WH27_MANES; Uncharacterized protein
STRINGLus100006430.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.16e-55SBP family protein