PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10000531
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family GRAS
Protein Properties Length: 334aa    MW: 35158.8 Da    PI: 6.9141
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10000531genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS36.56.9e-12240296258
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvs 58 
                  ++lL  cA a+++g+++++q+lL  l+el+s +g++++Rlaay ++AL ++l+ +++
  Lus10000531 240 EQLLNPCAAAITAGNFSRVQHLLYVLHELSSLTGSANHRLAAYGLRALTHHLSTTTN 296
                  689*************************************************98333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS509859.246213333IPR005202Transcription factor GRAS
PfamPF035142.4E-9240296IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MTSEGSHPNS QLHDPTAAAA ASDHMLDCWL ESVSYLPSFL DDTNDINSYP WWIPPDEFGH  60
DPLLPPSTIS NPSHHHHHHQ LQQNHQLNHG GGTTSTTTMA AATPQSMPSP DIISTFQTIP  120
TSHLIQQENT ITKYDHPQAS NLPRKRKLPD VPVPRPSPVN IPHVKKSQSQ SQSQSCDDHH  180
QDSSSGGGGG DSSAVIESGG GTVAASGCGG GVKKANGGKK GEKQNPLCAG GSNKEGRWAE  240
QLLNPCAAAI TAGNFSRVQH LLYVLHELSS LTGSANHRLA AYGLRALTHH LSTTTNTSPA  300
AAMGPPGAPN FAATEARVLQ TTASEIATQI LRG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1142147PRKRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68743447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.11e-19GRAS family protein