PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa019666
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family SBP
Protein Properties Length: 345aa    MW: 39055 Da    PI: 8.1023
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-39902PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP124.25.3e-39112187277
                -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
        SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                C+v+gC++ l ++k+yh+rhkvCe hsk+++v+v+g+eqrfCqqCsrfh l+efD++krsCr+rLa+hnerrrk++
  Lsa019666 112 CKVHGCNKSLVSCKDYHKRHKVCELHSKTAKVIVHGVEQRFCQQCSRFHLLKEFDDGKRSCRKRLADHNERRRKPH 187
                **************************************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114131.299109186IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.106.1E-31109173IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.66E-36110189IPR004333Transcription factor, SBP-box
PfamPF031101.2E-29112185IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MESWTFDSKA KMGSLDWESK SPFIFENNMV FSNNAMCVEN QGFGEICFPQ IVGNSLSSPI  60
MGATHNKFLE EHESSSELLS SVVESNQLLD LTTHVASKQK RTMVFNSLSP LCKVHGCNKS  120
LVSCKDYHKR HKVCELHSKT AKVIVHGVEQ RFCQQCSRFH LLKEFDDGKR SCRKRLADHN  180
ERRRKPHSSR HGRLLPPYHP TGTKVKGSTK TRARSSIIDI DQYPSLYVDN NEYIQASNSH  240
LFPFLNKDQS GGEEDFITMD STCALSPLSS QSHGSSSFHL SRNPTSWTHA LNQNTHLASG  300
VLNNMNPLMV GSEYINSQNR LWCDEVSTVD LLHLSSQLER VELHK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-261111851084squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023732803.10.0squamosa promoter-binding-like protein 6 isoform X1
TrEMBLA0A2J6KHS60.0A0A2J6KHS6_LACSA; Uncharacterized protein
STRINGEOY221292e-58(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.16e-41SBP family protein