PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa019305
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family VOZ
Protein Properties Length: 515aa    MW: 58489.8 Da    PI: 6.1553
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-46777PU_refplantGDBView CDS
gnl|UG|Lsa#S58689124PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ3982.1e-1222504721216
        VOZ   1 pppsaflgpkcalwdctrpaqg..se.....wlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaa 93 
                pppsaflgpkcalwdc+rpaqg  se     w+++ycs +hat+a neg+pg+tpv+rpkgi+lkd+l faal ak+qgk vg+pecegaatakspwna+
  Lsa019305 250 PPPSAFLGPKCALWDCPRPAQGwcSEravqwWCTNYCSGLHATIAQNEGQPGMTPVIRPKGIELKDNLPFAALCAKAQGKTVGVPECEGAATAKSPWNAP 349
                89*******************955223344489******************************************************************* PP

        VOZ  94 elfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdek 193
                elfdls++eget+rewlffdkprrafesgnrkqrslpdy+grgwhesrkqv++e g lkrsyymdpqp++ +ewhlyeyein++d++alyrlelklvd+k
  Lsa019305 350 ELFDLSVFEGETLREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQVINESGWLKRSYYMDPQPMKFLEWHLYEYEINKYDTCALYRLELKLVDKK 449
                **************************************************************************************************** PP

        VOZ 194 ksakgkvskdsladlqkklgrlt 216
                ks+kgk++++s+ +lqk++grl+
  Lsa019305 450 KSPKGKIANESVINLQKQMGRLK 472
                *********************96 PP

Sequence ? help Back to Top
Protein Sequence    Length: 515 aa     Download sequence    Send to blast
PESLTSGDAI DHFEVEGTKF SLYDPNPCKS LTHSHLEYQN KCDCWREERE ITSYHSLLRM  60
RRGAKSHRIF KDRAMNRVDD LQGMFMDLQS ARKDSRNIDM AVLEEQVHQM LKEWKKELNE  120
PSPSPSLQQG ASLRSFSPDI SRLLQLYDEE DDATSGLAAP KPDPDAQNTT QNATFHKNFL  180
ATQMCQEQGV DTSFGINTTG VHNPGVDTQF DYISFDMPRG FEQNCNDGVY GMWGEDALPQ  240
IATYLPNICP PPSAFLGPKC ALWDCPRPAQ GWCSERAVQW WCTNYCSGLH ATIAQNEGQP  300
GMTPVIRPKG IELKDNLPFA ALCAKAQGKT VGVPECEGAA TAKSPWNAPE LFDLSVFEGE  360
TLREWLFFDK PRRAFESGNR KQRSLPDYNG RGWHESRKQV INESGWLKRS YYMDPQPMKF  420
LEWHLYEYEI NKYDTCALYR LELKLVDKKK SPKGKIANES VINLQKQMGR LKGRGKGCAT  480
VYPDLSQTKR TLDGEYGGNT GFNYLIEDLG GYYLT
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023736720.10.0transcription factor VOZ1-like isoform X1
RefseqXP_023736722.10.0transcription factor VOZ1-like isoform X1
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A2J6K8X90.0A0A2J6K8X9_LACSA; Uncharacterized protein
STRINGEOY281330.0(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]