PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa019160
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family G2-like
Protein Properties Length: 242aa    MW: 27562.9 Da    PI: 5.2139
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S32106242PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-27166PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.52.2e-31185240156
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                k+r++W+ eLH+rF+ a+++LGGs+ AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Lsa019160 185 KQRRCWSAELHRRFIAALQELGGSQAATPKQIRELMQVDGLTNDEVKSHLQKYRLH 240
                79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.348182242IPR017930Myb domain
SuperFamilySSF466893.49E-16183240IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-27184240IPR009057Homeodomain-like
TIGRFAMsTIGR015573.3E-26185240IPR006447Myb domain, plants
PfamPF002491.3E-7187238IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MGSLNPSPEI TLDFRPTFIP KTIGQFLGEV SRISNVTEKL LQVDDFVKRL ETETRKIEAF  60
KDLPLCMLLM NDAIYALKEE SMMLKKTPNS EPVLEEFISL KNNCDDDSKL EIIENNXENS  120
DKKNWLSSTQ LWNTNENSEE EDVGIKNPMI PCSTQNLQSN IRNGCTPPPP PPSPPPPPQQ  180
QVARKQRRCW SAELHRRFIA ALQELGGSQA ATPKQIRELM QVDGLTNDEV KSHLQKYRLH  240
TX
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010107986.11e-68Two-component response regulator
TrEMBLA0A118K6I91e-110A0A118K6I9_CYNCS; Homeodomain-like protein
STRINGGLYMA07G29490.14e-68(Glycine max)
STRINGGLYMA20G01260.14e-68(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.11e-49G2-like family protein