PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa018848
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family MIKC_MADS
Protein Properties Length: 241aa    MW: 27940.1 Da    PI: 9.6875
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58681456PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-44321PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.91.5e-29959151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               krienk+ rqvtfskRr+g+lKKA+E+SvLCda+va+i+fs++gkl+ey++
  Lsa018848  9 KRIENKISRQVTFSKRRTGLLKKAHEISVLCDADVALIVFSTKGKLFEYAT 59
               79***********************************************86 PP

2K-box95.67.7e-32811747100
      K-box   7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                ++ e+++++s++ e++kLk++ie L++++Rh+ GedLe+L+l+eLq++eqqLe++lk+iR+kKn+l++e+i+el kke++lqe+n++L+kkl+e
  Lsa018848  81 TAPETETQASWTLESSKLKAKIEVLEKNIRHYDGEDLEQLNLRELQNVEQQLETALKRIRTKKNQLMHESISELHKKERALQERNNSLSKKLKE 174
                455677889**********************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.721161IPR002100Transcription factor, MADS-box
SMARTSM004323.7E-39160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-33292IPR002100Transcription factor, MADS-box
CDDcd002656.07E-41276No hitNo description
PRINTSPR004042.1E-30323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003193.0E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-303859IPR002100Transcription factor, MADS-box
PfamPF014862.8E-2685172IPR002487Transcription factor, K-box
PROSITE profilePS5129716.488178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MGRGRVQLKR IENKISRQVT FSKRRTGLLK KAHEISVLCD ADVALIVFST KGKLFEYATH  60
SSMETILERY ERYSYAEKLL TAPETETQAS WTLESSKLKA KIEVLEKNIR HYDGEDLEQL  120
NLRELQNVEQ QLETALKRIR TKKNQLMHES ISELHKKERA LQERNNSLSK KLKENEKTSE  180
QQIPMLHLPQ HPPQPYPCSV PSFANTSGPF IGAAMREEES VQVQPVSTTM MPLWMIRHIN  240
Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A3e-21174173MEF2 CHIMERA
6byy_B3e-21174173MEF2 CHIMERA
6byy_C3e-21174173MEF2 CHIMERA
6byy_D3e-21174173MEF2 CHIMERA
6bz1_A3e-21174173MEF2 CHIMERA
6bz1_B3e-21174173MEF2 CHIMERA
6bz1_C3e-21174173MEF2 CHIMERA
6bz1_D3e-21174173MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023771445.11e-179truncated transcription factor CAULIFLOWER A-like
SwissprotQ424296e-96AGL8_SOLTU; Agamous-like MADS-box protein AGL8 homolog
TrEMBLA0A2J6KWZ11e-178A0A2J6KWZ1_LACSA; Uncharacterized protein
STRINGXP_004304203.11e-101(Fragaria vesca)
Publications ? help Back to Top
  1. Kang SG,Hannapel DJ
    Nucleotide sequences of novel potato (Solanum tuberosum L.) MADS-box cDNAs and their expression in vegetative organs.
    Gene, 1995. 166(2): p. 329-30
    [PMID:8543185]