PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa018840
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family SBP
Protein Properties Length: 183aa    MW: 20913.3 Da    PI: 9.3725
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S29946036PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-35709PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.61.2e-4068145178
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                +Cq+e+C++dl+eak+yhrrh+vCe+h+ka +++++g++qrfCqqCsrfhelsefDe+krsCrrrLa+hnerrrk+++
  Lsa018840  68 CCQAEKCTSDLAEAKQYHRRHRVCEFHAKAHAAIIAGIHQRFCQQCSRFHELSEFDEAKRSCRRRLAGHNERRRKNSM 145
                6**************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.6E-3164130IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.61666143IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.67E-3767147IPR004333Transcription factor, SBP-box
PfamPF031101.1E-3069142IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MERKSNKVSS REKLNMTKND LVNDNYDHEL MGGSYGGDGE DGGGSSNGDV KKKKGCQNSG  60
GLNSVTRCCQ AEKCTSDLAE AKQYHRRHRV CEFHAKAHAA IIAGIHQRFC QQCSRFHELS  120
EFDEAKRSCR RRLAGHNERR RKNSMEFKGT GKELVCVQSD DRRFQMVIQE NQTYNNNKHL  180
QTR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-3655142184squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023768847.11e-133squamosa promoter-binding protein 1-like
TrEMBLA0A2J6L2Y21e-121A0A2J6L2Y2_LACSA; Uncharacterized protein
STRINGVIT_12s0028g03350.t014e-54(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.24e-34squamosa promoter binding protein-like 4