PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa018757
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family Trihelix
Protein Properties Length: 391aa    MW: 44299.4 Da    PI: 7.0225
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-2193PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix86.72.8e-2773156286
   trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                W ++e++ Li +rre+++ ++++k++k+lWe++s+kmr++gf rsp++C++kw+nl k++kk+k+ ++k++s+s+ ++ y+++le
  Lsa018757  73 WVQEETRILISLRREVDRFFNTSKSNKHLWEQISSKMRDKGFDRSPTMCTDKWRNLLKEFKKVKHKNSKGSSGST-KMLYYKDLE 156
                **********************************************************************77666.899***998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500908.82765129IPR017877Myb-like domain
SMARTSM007178.1E-669131IPR001005SANT/Myb domain
CDDcd122031.36E-2671136No hitNo description
Gene3DG3DSA:1.10.10.601.7E-572130IPR009057Homeodomain-like
PfamPF138371.3E-1972158No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MYLSSEKPRS IDFYKEVAGG GDRNMLIESE QTPHNHQQQH QQQQLMIMAE NNNNTSSGED  60
HELRAPKKRA ETWVQEETRI LISLRREVDR FFNTSKSNKH LWEQISSKMR DKGFDRSPTM  120
CTDKWRNLLK EFKKVKHKNS KGSSGSTKML YYKDLEELIR DRAKDGTYKA ASPTSSKLDS  180
FIQFSDKGLD DGSIPFGPME ANGRSTVNIE RPLDNDGDPL AITTAEAVAG NGVPPWNWRD  240
TPGNGGEGQS CYGRIITVKW GEYTRRVGID GSAKAIKEAI KSAFGIRSKR AFWLEDEDGV  300
IRALDRTMPV GNYNLHLDEG VSIKICHYDE SERIAVRTED KTFYTEEDLH EFLSGRGLSG  360
LREINGYRSF NNVDDLRLGA AYQGVRLLGG D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A4e-3967154186DNA binding protein GT-1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds specifically to the core DNA sequence 5'-GGTTAA-3'. May act as a molecular switch in response to light signals. {ECO:0000269|PubMed:10437822, ECO:0000269|PubMed:15044016, ECO:0000269|PubMed:7866025}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023773043.10.0trihelix transcription factor GT-1-like
SwissprotQ9FX531e-160TGT1_ARATH; Trihelix transcription factor GT-1
TrEMBLA0A2J6MDV80.0A0A2J6MDV8_LACSA; Uncharacterized protein
STRINGVIT_14s0171g00450.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13450.11e-152Trihelix family protein
Publications ? help Back to Top
  1. Le Gourrierec J,Li YF,Zhou DX
    Transcriptional activation by Arabidopsis GT-1 may be through interaction with TFIIA-TBP-TATA complex.
    Plant J., 1999. 18(6): p. 663-8
    [PMID:10417717]