PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa018582
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family NAC
Protein Properties Length: 352aa    MW: 38890.4 Da    PI: 4.5541
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-53181PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM151.24.8e-4761331128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                l pGfrFhPtd+elv++yLk+k+ gk++ + ++++ev+iy++ PwdLp k ++k+++ ew+fF++++kky++g r+nr+t+sg+Wkatgkd++v   kg+
  Lsa018582   6 LIPGFRFHPTDHELVMYYLKRKLLGKRIIV-NAVAEVNIYEFSPWDLPdKsSLKSGDLEWFFFCPKSKKYSSGARSNRTTESGFWKATGKDRKVEY-KGR 103
                579************************999.88**************96347777888*************************************9.999 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                +v   ktLvf+ ++a++g++t+Wvmhey++
  Lsa018582 104 VVARIKTLVFHLKTASDGQRTNWVMHEYNM 133
                9***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.72E-563156IPR003441NAC domain
PROSITE profilePS5100552.0956156IPR003441NAC domain
PfamPF023654.0E-258132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MERSSLIPGF RFHPTDHELV MYYLKRKLLG KRIIVNAVAE VNIYEFSPWD LPDKSSLKSG  60
DLEWFFFCPK SKKYSSGARS NRTTESGFWK ATGKDRKVEY KGRVVARIKT LVFHLKTASD  120
GQRTNWVMHE YNMEDQKLAD EGVVQDMYVL CKIFEKEGAG PKNGAQYGAP FNEEEWDDDV  180
ASCSGPTNKP DDKQKGPLTL SLTEPGSSTI TYSANETVIY KQKGPAATIN NKTLPQSTCT  240
LTEPAPSSSA NANANDTPGN DDDVMLYEDL ASIFGVPTGG LNSNNKDKGV EVKGVGPNED  300
EGIFGDLVNL VNLDDFVGAE LNRFETDGSE YTMGMMMGAD DLDVDLGRFC VD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-43116212171NO APICAL MERISTEM PROTEIN
1ut4_B5e-43116212171NO APICAL MERISTEM PROTEIN
1ut7_A5e-43116212171NO APICAL MERISTEM PROTEIN
1ut7_B5e-43116212171NO APICAL MERISTEM PROTEIN
3swm_A7e-43116215174NAC domain-containing protein 19
3swm_B7e-43116215174NAC domain-containing protein 19
3swm_C7e-43116215174NAC domain-containing protein 19
3swm_D7e-43116215174NAC domain-containing protein 19
3swp_A7e-43116215174NAC domain-containing protein 19
3swp_B7e-43116215174NAC domain-containing protein 19
3swp_C7e-43116215174NAC domain-containing protein 19
3swp_D7e-43116215174NAC domain-containing protein 19
4dul_A5e-43116212171NAC domain-containing protein 19
4dul_B5e-43116212171NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A103XFW71e-90A0A103XFW7_CYNCS; No apical meristem (NAM) protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09330.44e-85NAC domain containing protein 82