PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa018542
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family G2-like
Protein Properties Length: 335aa    MW: 37760.9 Da    PI: 8.2017
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-256385PU_refplantGDBView CDS
gnl|UG|Lsa#S29958904PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.21.6e-32244299156
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                k+r++W++eLH+rFv+a++qLGGs+ AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Lsa018542 244 KQRRCWSTELHRRFVNALQQLGGSQAATPKQIRELMQVDGLTNDEVKSHLQKYRLH 299
                79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-29241302IPR009057Homeodomain-like
PROSITE profilePS5129413.57241301IPR017930Myb domain
SuperFamilySSF466893.59E-18241302IPR009057Homeodomain-like
TIGRFAMsTIGR015574.3E-27244299IPR006447Myb domain, plants
PfamPF002491.2E-7246297IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MGSLNPPPEL SLDFKPTFIP KTISQFLEQV STIATLSDKI LKLDDFVTRL EAEMRKIDAF  60
KRELPLCMLL INDAIITLKE ETIVLKKSSN PEPVLEEFIP LKNTSDEDAK LEIISKEKCG  120
GDKKNWLSTT QLWNNPNPNP NPNTNQTQIW KPKSIHQITK KRTDEEDDGM IDDPYPTKAF  180
IPYKGICGFT VVEEDKEESP IPGLSLITPG IKNPMRGNLL LTKTNSNSRL LPCSSPNAQQ  240
TSRKQRRCWS TELHRRFVNA LQQLGGSQAA TPKQIRELMQ VDGLTNDEVK SHLQKYRLHT  300
RRLPPSSNNS SANQSGVVLG GLWMGFQDSY VESSX
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008236633.11e-118PREDICTED: uncharacterized protein LOC103335407
TrEMBLA0A118JUZ11e-172A0A118JUZ1_CYNCS; Homeodomain-like protein
STRINGVIT_03s0063g01060.t011e-113(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.13e-57G2-like family protein