PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa018309
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family SBP
Protein Properties Length: 465aa    MW: 51245.4 Da    PI: 9.623
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58687908PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-45373PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.11.6e-40169246178
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                +CqvegC+ dls+akeyhr+h+vCe hsk+p+v+v  le+rfCqqCsrfh lsefDe+krsCrrrL++hn+rrrk+q+
  Lsa018309 169 RCQVEGCNLDLSSAKEYHRKHRVCESHSKSPKVVVGTLERRFCQQCSRFHGLSEFDERKRSCRRRLSDHNARRRKPQQ 246
                6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.6E-33163231IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.513167244IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.41E-38168249IPR004333Transcription factor, SBP-box
PfamPF031102.2E-30170243IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MEWNTKWDWE NHEIFSSKVM ASPKKLNTNY EEDMDGSFNL SGVVGGSGGS ASDMGNSSIS  60
ASTESSFKDG NGNGNGNGNG NGNGIGVRVS KFPFQGFAGF PNSSKKEFES PPPSVSSGEP  120
FIGLKLGKRT YFENNNSKTS SFSDIPISSV STVKKVKSSS YSQATPTPRC QVEGCNLDLS  180
SAKEYHRKHR VCESHSKSPK VVVGTLERRF CQQCSRFHGL SEFDERKRSC RRRLSDHNAR  240
RRKPQQETIQ FNSTNISSSF YGGRQNLSFV LNNGGPLVQS RPPAVSSTWE NSSVNMPTTI  300
GFNRSVPLKA TRVEALDQGF KESLSPPNVD ALDIRRALSL LSNNTWGVYE SDLVAVEHHN  360
HTHTGTGNPI QHGMQSVPQL PPEEEYWRQP EPPLMPPPKQ AIPSPPLNSK TFSFLTASIP  420
IQFQWMKSMM ILPYPNLNLF RCFCSFLGLP LPGPALINNK VSRGG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-291702431184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1225242RKRSCRRRLSDHNARRRK
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023741755.10.0squamosa promoter-binding-like protein 12
RefseqXP_023741756.10.0squamosa promoter-binding-like protein 12
RefseqXP_023741757.10.0squamosa promoter-binding-like protein 12
RefseqXP_023741758.10.0squamosa promoter-binding-like protein 12
RefseqXP_023741759.10.0squamosa promoter-binding-like protein 12
RefseqXP_023741760.10.0squamosa promoter-binding-like protein 12
SwissprotA2YGR51e-69SPL12_ORYSI; Squamosa promoter-binding-like protein 12
TrEMBLA0A2J6JY080.0A0A2J6JY08_LACSA; Uncharacterized protein
STRINGVIT_01s0010g03710.t011e-95(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.35e-47squamosa promoter binding protein-like 2