PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa017783
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family G2-like
Protein Properties Length: 324aa    MW: 35349 Da    PI: 6.0428
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58687483PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-29647PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.92.7e-29154205355
    G2-like   3 rlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                rl+Wtp+LH+rFve+v++L G ++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Lsa017783 154 RLVWTPQLHKRFVEVVAHL-GVKNAVPKTIMQLMNVEGLTRENVASHLQKYRL 205
                9******************.9*******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.533149208IPR017930Myb domain
SuperFamilySSF466891.58E-18150209IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.6E-29151210IPR009057Homeodomain-like
TIGRFAMsTIGR015574.4E-23154205IPR006447Myb domain, plants
PfamPF002498.4E-9155204IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MGEEVRITDF DVSGGDDDDR VSEWEAGLPN VDDLPSLSQL LISAEMASAF SITPGPHRSM  60
IDVDRASRNT ISSLQGQSQQ NQVNKHTDFK SFSDDREEEM VVEGEETVDL TPDGSDSRKL  120
RRVDSGGASG GAGEEADSAL RADDSSTKSL KRIRLVWTPQ LHKRFVEVVA HLGVKNAVPK  180
TIMQLMNVEG LTRENVASHL QKYRLYVKRM HGSSNEGPSS SDPLFASATV PKSFHDSGGN  240
GGVGNRNGHS HVPIPMPYPQ QMVPLAYPPP QMVPNRSGGG GSAYHQGFSP HSHPYNMMMQ  300
PRDWSGNNFG SVSPFHQSRT PNDN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A8e-19151210463ARR10-B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002283159.11e-109PREDICTED: transcription factor PCL1
RefseqXP_010650997.11e-109PREDICTED: transcription factor PCL1
RefseqXP_010650998.11e-109PREDICTED: transcription factor PCL1
SwissprotQ9SNB48e-77PCL1_ARATH; Transcription factor LUX
TrEMBLA0A118JWU01e-142A0A118JWU0_CYNCS; Homeodomain-like protein
STRINGVIT_06s0004g05120.t011e-109(Vitis vinifera)