PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa016895
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family NAC
Protein Properties Length: 339aa    MW: 38052.6 Da    PI: 9.1415
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-41474PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.72e-52141391128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                lppGfrF Ptdeel+v+yL++kv+g++++l ++i+++d+yk++Pw+Lp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk +++ +g+ v
  Lsa016895  14 LPPGFRFFPTDEELLVQYLCRKVAGHDFSL-QIIADIDLYKFDPWELPSKAMFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKVITT-GGRRV 111
                79***************************9.89***************8777899*************************************99.999** PP

        NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
                g+kk Lvfy g+apkg+kt+W+mheyrl
  Lsa016895 112 GIKKALVFYVGKAPKGNKTNWIMHEYRL 139
                **************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.01E-679163IPR003441NAC domain
PROSITE profilePS5100561.27714162IPR003441NAC domain
PfamPF023656.2E-2615139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MGLPVTDPMT QLSLPPGFRF FPTDEELLVQ YLCRKVAGHD FSLQIIADID LYKFDPWELP  60
SKAMFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKVITTGGRR VGIKKALVFY  120
VGKAPKGNKT NWIMHEYRLS EPQRKNGSSR LDDWVLCRIY KKNSSAQKHI SGGAPTTEQS  180
HGSSSSSSSQ FDDVLESLPE IEDRFFNLPR INSLKTFQQE DQKVNLQKFD SGNYDWASIA  240
AFGLPEPATG SQAPTTANTA MNVIPSMAPA TTYTMDATFG RSVEDEVQSG IRSQRVEHPG  300
SGYFQSNLNQ FTQSQGFSNT MDPFGIRYPT QQGNLGFRR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-10911684171NO APICAL MERISTEM PROTEIN
1ut4_B1e-10911684171NO APICAL MERISTEM PROTEIN
1ut7_A1e-10911684171NO APICAL MERISTEM PROTEIN
1ut7_B1e-10911684171NO APICAL MERISTEM PROTEIN
3swm_A1e-10911687174NAC domain-containing protein 19
3swm_B1e-10911687174NAC domain-containing protein 19
3swm_C1e-10911687174NAC domain-containing protein 19
3swm_D1e-10911687174NAC domain-containing protein 19
3swp_A1e-10911687174NAC domain-containing protein 19
3swp_B1e-10911687174NAC domain-containing protein 19
3swp_C1e-10911687174NAC domain-containing protein 19
3swp_D1e-10911687174NAC domain-containing protein 19
4dul_A1e-10911684171NAC domain-containing protein 19
4dul_B1e-10911684171NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011095243.11e-163PREDICTED: NAC domain-containing protein 72-like
SwissprotQ93VY31e-124NAC72_ARATH; NAC domain-containing protein 72
TrEMBLA0A124SHT00.0A0A124SHT0_CYNCS; No apical meristem (NAM) protein
STRINGSolyc07g063410.2.11e-157(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-125NAC family protein